KEGG   Homo sapiens (human): 50807Help
Entry
50807             CDS       T01001                                 

Gene name
ASAP1, AMAP1, CENTB4, DDEF1, PAG2, PAP, ZG14P
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    50807 (ASAP1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    50807 (ASAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    50807 (ASAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9ULH1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.21-q24.22
AA seq 1129 aa AA seqDB search
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttcagcctccaggctctccagtttttcgtcgagagattcactatggaatcgg
atgccggaccagatctctgtctcggagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacaccgtcacgctgctg
gaggaggctctagaccaagatagaacagcccttcagaaagtgaagaagtctgtaaaagca
atatataattctggtcaagatcatgtacaaaatgaagaaaactatgcacaagttcttgat
aagtttgggagtaattttttaagtcgagacaaccccgaccttggcaccgcgtttgtcaag
ttttctactcttacaaaggaactgtccacactgctgaaaaatctgctccagggtttgagc
cacaatgtgatcttcaccttggattctttgttaaaaggagacctaaagggagtcaaagga
gatctcaagaagccatttgacaaagcctggaaagattatgagacaaagtttacaaaaatt
gagaaagagaaaagagagcacgcaaaacaacatgggatgatccgcacagagataacagga
gctgagattgcggaagaaatggagaaggaaaggcgcctctttcagctccaaatgtgtgaa
tatctcattaaagttaatgaaatcaagaccaaaaagggtgtggatctgctgcagaatctt
ataaagtattaccatgcacagtgcaatttctttcaagatggcttgaaaacagctgataag
ttgaaacagtacattgaaaaactggctgctgatttatataatataaaacagacccaggat
gaagaaaagaaacagctaactgcactccgagacttaataaaatcctctcttcaactggat
cagaaagaagattctcagagccggcaaggaggatacagcatgcatcagctccagggcaat
aaggaatatggcagtgaaaagaaggggtacctgctaaagaaaagtgacgggatccggaaa
gtatggcagaggaggaagtgttcagtcaagaatgggattctgaccatctcacatgccaca
tctaacaggcaaccagccaagttgaaccttctcacctgccaagtaaaacctaatgccgaa
gacaaaaaatcttttgacctgatatcacataatagaacatatcactttcaggcagaagat
gagcaggattatgtagcatggatatcagtattgacaaatagcaaagaagaggccctaacc
atggccttccgtggagagcagagtgcgggagagaacagcctggaagacctgacaaaagcc
attattgaggatgtccagcggctcccagggaatgacatttgctgcgattgtggctcatca
gaacccacctggctttcaaccaacttgggtattttgacctgtatagaatgttctggcatc
catagggaaatgggggttcatatttctcgcattcagtctttggaactagacaaattagga
acttctgaactcttgctggccaagaatgtaggaaacaatagttttaatgatattatggaa
gcaaatttacccagcccctcaccaaaacccaccccttcaagtgatatgactgtacgaaaa
gaatatatcactgcaaagtatgtagatcataggttttcaaggaagacctgttcaacttca
tcagctaaactaaatgaattgcttgaggccatcaaatccagggatttacttgcactaatt
caagtctatgcagaaggggtagagctaatggaaccactgctggaacctgggcaggagctt
ggggagacagcccttcaccttgccgtccgaactgcagatcagacatctctccatttggtt
gacttccttgtacaaaactgtgggaacctggataagcagacggccctgggaaacacagtt
ctacactactgtagtatgtacagtaaacctgagtgtttgaagcttttgctcaggagcaag
cccactgtggatatagttaaccaggctggagaaactgccctagacatagcaaagagacta
aaagctacccagtgtgaagatctgctttcccaggctaaatctggaaagttcaatccacac
gtccacgtagaatatgagtggaatcttcgacaggaggagatagatgagagcgatgatgat
ctggatgacaaaccaagccctatcaagaaagagcgctcacccagacctcagagcttctgc
cactcctccagcatctccccccaggacaagctggcactgccaggattcagcactccaagg
gacaaacagcggctctcctatggagccttcaccaaccagatcttcgtttccacaagcaca
gactcgcccacatcaccaaccacggaggctccccctctgcctcctaggaacgccgggaaa
ggtccaactggcccaccttcaacactccctctaagcacccagacctctagtggcagctcc
accctatccaagaagaggcctcctcccccaccacccggacacaagagaaccctatccgac
cctcccagcccactacctcatgggcccccaaacaaaggcgcagttccttggggtaacgat
gggggtccatcctcttcaagtaagactacaaacaagtttgagggactatcccagcagtcg
agcaccagttctgcaaagactgcccttggcccaagagttcttcctaaactacctcagaaa
gtggcactaaggaaaacagatcatctctccctagacaaagccaccatcccgcccgaaatc
tttcagaaatcatcacagttggcagagttgccacaaaagccaccacctggagacctgccc
ccaaagcccacagaactggcccccaagccccaaattggagatttgccgcctaagccagga
gaactgccccccaaaccacagctgggggacctgccacccaaaccccaactctcagactta
cctcccaaaccacagatgaaggacctgccccccaaaccacagctgggagacctgctagca
aaatcccagactggagatgtctcacccaaggctcagcaaccctctgaggtcacactgaag
tcacacccattggatctatccccaaatgtgcagtccagagacgccatccaaaagcaagca
tctgaagactccaacgacctcacgcctactctgccagagacgcccgtaccactgcccaga
aaaatcaatacggggaaaaataaagtgaggcgagtgaagaccatttatgactgccaggca
gacaacgatgacgagctcacattcatcgagggagaagtgattatcgtcacaggggaagag
gaccaggagtggtggattggccacatcgaaggacagcctgaaaggaagggggtctttcca
gtgtcctttgttcatatcctgtctgactag

DBGET integrated database retrieval system