KEGG   Homo sapiens (human): 5081Help
Entry
5081              CDS       T01001                                 

Gene name
PAX7, HUP1, PAX7B, RMS2
Definition
(RefSeq) paired box 7
  KO
K09381  
paired box protein 3/7
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00037  
Alveolar rhabdomyosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5081 (PAX7)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box plus homeo domain
    5081 (PAX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P23759(Tbio)
UniProt: 
Position
1p36.13
AA seq 505 aa AA seqDB search
MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEE
YKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDG
EKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTH
YPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTL
PPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSSAYGARHSFSS
YSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSIS
ASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQTAVDYLAKNVSLS
TQRRMKLGEHSAVLGLLPVETGQAY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccttcccggcacggtaccgagaatgatgcggccggctccggggcagaactac
ccccgcacgggattccctttggaagtgtccaccccgcttggccaaggccgggtcaatcag
ctgggaggggtcttcatcaatgggcgacccctgcctaaccacatccgccacaagatagtg
gagatggcccaccatggcatccggccctgtgtcatctcccgacagctgcgtgtctcccac
ggctgcgtctccaagattctttgccgctaccaggagaccgggtccatccggcctggggcc
atcggcggcagcaagcccagacaggtggcgactccggatgtagagaaaaagattgaggag
tacaagagggaaaacccaggcatgttcagctgggagatccgggacaggctgctgaaggat
gggcactgtgaccgaagcactgtgccctcaggtttagtgagttcgattagccgcgtgctc
agaatcaagttcgggaagaaagaggaggaggatgaagcggacaagaaggaggacgacggc
gaaaagaaggccaaacacagcatcgacggcatcctgggcgacaaagggaaccggctggac
gagggctcggatgtggagtcggaacctgacctcccactgaagcgcaagcagcgacgcagt
cggaccacattcacggccgagcagctggaggagctggagaaggcctttgagaggacccac
tacccagacatatacacccgcgaggagctggcgcagaggaccaagctgacagaggcgcgt
gtgcaggtctggttcagtaaccgccgcgcccgttggcgtaagcaggcaggagccaaccag
ctggcggcgttcaaccaccttctgccaggaggcttcccacccaccggcatgcccacgctg
cccccctaccagctgccggactccacctaccccaccaccaccatctcccaagatgggggc
agcactgtgcaccggcctcagcccctgccaccgtccaccatgcaccagggcgggctggct
gcagcggctgcagccgccgacaccagctctgcctacggagcccgccacagcttctccagc
tactctgacagcttcatgaatccggcggcgccctccaaccacatgaacccggtcagcaac
ggcctgtctcctcaggtgatgagcatcttgggcaaccccagtgcggtgcccccgcagcca
caggctgacttctccatctccccgctgcatggcggcctggactcggccacctccatctca
gccagctgcagccagcgggccgactccatcaagccaggagacagcctgcccacctcccag
gcctactgcccacccacctacagcaccaccggctacagcgtggaccccgtggccggctat
cagtacggccagtacggccagactgctgttgattatctggccaaaaatgtgagcctctcc
acccagcgtcgcatgaagctcggggagcactctgctgtgctgggactcctgcctgtggaa
actggccaggcctactag

DBGET integrated database retrieval system