KEGG   Homo sapiens (human): 50838Help
Entry
50838             CDS       T01001                                 

Gene name
TAS2R13, T2R13, TRB3
Definition
taste receptor, type 2, member 13
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Class
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13
AA seq 303 aa AA seqDB search
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
AKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgccctgccgagtatcttcactcttgtaataattgcagaattcataattggg
aatttgagcaatggatttatagtactgatcaactgcattgactgggtcagtaaaagagag
ctgtcctcagtcgataaactcctcattatcttggcaatctccagaattgggctgatctgg
gaaatattagtaagttggtttttagctctgcattatctagccatatttgtgtctggaaca
ggattaagaattatgatttttagctggatagtttctaatcacttcaatctctggcttgct
acaatcttcagcatcttttatttgctcaaaatagcgagtttctctagccctgcttttctc
tatttgaagtggagagtaaacaaagtgattctgatgatactgctaggaaccttggtcttc
ttatttttaaatctgatacaaataaacatgcatataaaagactggctggaccgatatgaa
agaaacacaacttggaatttcagtatgagtgactttgaaacattttcagtgtcggtcaaa
ttcactatgactatgttcagtctaacaccatttactgtggccttcatctcttttctcctg
ttaattttctccctgcagaaacatctccagaaaatgcaactcaattacaaaggacacaga
gaccccaggaccaaggtccatacaaatgccttgaaaattgtgatctcattccttttattc
tatgctagtttctttctatgtgttctcatatcatggatttctgagctgtatcagaacaca
gtgatctacatgctttgtgagacgattggagtcttctctccttcaagccactcctttctt
ctgattctaggaaacgctaagttaagacaggcctttcttttggtggcagctaaggtatgg
gctaaacgatga

DBGET integrated database retrieval system