KEGG   Homo sapiens (human): 50840Help
Entry
50840             CDS       T01001                                 

Gene name
TAS2R14, T2R14, TRB1
Definition
taste receptor, type 2, member 14
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    50840 (TAS2R14)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste type 2
    50840 (TAS2R14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12p13
AA seq 317 aa AA seqDB search
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW
LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL
YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV
LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY
AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY
MFKDGEPSGHKEFRESS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgtcataaagagcatatttacattcgttttaattgtggaatttataattgga
aatttaggaaatagtttcatagcactggtgaactgtattgactgggtcaagggaagaaag
atctcttcggttgatcggatcctcactgctttggcaatctctcgaattagcctggtttgg
ttaatattcggaagctggtgtgtgtctgtgtttttcccagctttatttgccactgaaaaa
atgttcagaatgcttactaatatctggacagtgatcaatcattttagtgtctggttagct
acaggcctcggtactttttattttctcaagatagccaatttttctaactctatttttctc
tacctaaagtggagggttaaaaaggtggttttggtgctgcttcttgtgacttcggtcttc
ttgtttttaaatattgcactgataaacatccatataaatgccagtatcaatggatacaga
agaaacaagacttgcagttctgattcaagtaactttacacgattttccagtcttattgta
ttaaccagcactgtgttcattttcataccctttactttgtccctggcaatgtttcttctc
ctcatcttctccatgtggaaacatcgcaagaagatgcagcacactgtcaaaatatccgga
gacgccagcaccaaagcccacagaggagttaaaagtgtgatcactttcttcctactctat
gccattttctctctgtcttttttcatatcagtttggacctctgaaaggttggaggaaaat
ctaattattctttcccaggtgatgggaatggcttatccttcatgtcactcatgtgttctg
attcttggaaacaagaagctgagacaggcctctctgtcagtgctactgtggctgaggtac
atgttcaaagatggggagccctcaggtcacaaagaatttagagaatcatcttga

DBGET integrated database retrieval system