KEGG   Homo sapiens (human): 50861Help
Entry
50861             CDS       T01001                                 

Gene name
STMN3, SCLIP
Definition
(RefSeq) stathmin 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.3
AA seq 180 aa AA seqDB search
MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccatttccgcctacaaggagaagatgaaggagctgtcggtgctgtcgctc
atctgctcctgcttctacacacagccgcaccccaataccgtctaccagtacggggacatg
gaggtgaagcagctggacaagcgggcctcaggccagagcttcgaggtcatcctcaagtcc
ccttctgacctgtccccagagagccctatgctctcctccccacccaagaagaaggacacc
tccctggaggagctgcaaaagcggctggaggcagccgaggagcggaggaagacgcaggag
gcgcaggtgctgaagcagctggcggagcggcgcgagcacgagcgcgaggtgctgcacaag
gcgctggaggagaataacaacttcagccgccaggcggaggagaagctcaactacaagatg
gagctcagcaaggagatccgcgaggcacacctggccgcactgcgcgagcggctgcgcgag
aaggagctgcacgcggccgaggtgcgcaggaacaaggagcagcgagaagagatgtcgggc
taa

DBGET integrated database retrieval system