KEGG   Homo sapiens (human): 50861Help
Entry
50861             CDS       T01001                                 

Gene name
STMN3, SCLIP
Definition
(RefSeq) stathmin 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin Exonuc_VII_L HrpF
Motif
Other DBs
NCBI-GeneID: 50861
NCBI-ProteinID: NP_056978
OMIM: 608362
HGNC: 15926
Ensembl: ENSG00000197457
Vega: OTTHUMG00000032985
Pharos: Q9NZ72(Tbio)
UniProt: Q9NZ72
Position
20q13.33
AA seq 180 aa AA seqDB search
MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccatttccgcctacaaggagaagatgaaggagctgtcggtgctgtcgctc
atctgctcctgcttctacacacagccgcaccccaataccgtctaccagtacggggacatg
gaggtgaagcagctggacaagcgggcctcaggccagagcttcgaggtcatcctcaagtcc
ccttctgacctgtccccagagagccctatgctctcctccccacccaagaagaaggacacc
tccctggaggagctgcaaaagcggctggaggcagccgaggagcggaggaagacgcaggag
gcgcaggtgctgaagcagctggcggagcggcgcgagcacgagcgcgaggtgctgcacaag
gcgctggaggagaataacaacttcagccgccaggcggaggagaagctcaactacaagatg
gagctcagcaaggagatccgcgaggcacacctggccgcactgcgcgagcggctgcgcgag
aaggagctgcacgcggccgaggtgcgcaggaacaaggagcagcgagaagagatgtcgggc
taa

DBGET integrated database retrieval system