KEGG   Homo sapiens (human): 50863Help
Entry
50863             CDS       T01001                                 

Gene name
NTM, CEPU-1, HNT, IGLON2, NTRI
Definition
(RefSeq) neurotrimin
  KO
K06774  neurotrimin
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    LSAMP, LAMP; limbic system-associated membrane protein [KO:K06772]
     50863 (NTM)
    HNT; neurotrimin [KO:K06774]
     50863 (NTM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_5 Izumo-Ig C2-set_2
Motif
Other DBs
NCBI-GeneID: 50863
NCBI-ProteinID: NP_001041674
OMIM: 607938
HGNC: 17941
Ensembl: ENSG00000182667
Vega: OTTHUMG00000066364
Pharos: Q9P121(Tbio)
UniProt: Q9P121
Position
11q25
AA seq 344 aa AA seqDB search
MKTIQPKMHNSISWAIFTGLAALCLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
NRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFV
SEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGT
LQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNK
LGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatccagccaaaaatgcacaattctatctcttgggcaatcttcacggggctg
gctgctctgtgtctcttccaaggagtgcccgtgcgcagcggagatgccaccttccccaaa
gctatggacaacgtgacggtccggcagggggagagcgccaccctcaggtgcactattgac
aaccgggtcacccgggtggcctggctaaaccgcagcaccatcctctatgctgggaatgac
aagtggtgcctggatcctcgcgtggtccttctgagcaacacccaaacgcagtacagcatc
gagatccagaacgtggatgtgtatgacgagggcccttacacctgctcggtgcagacagac
aaccacccaaagacctctagggtccacctcattgtgcaagtatctcccaaaattgtagag
atttcttcagatatctccattaatgaagggaacaatattagcctcacctgcatagcaact
ggtagaccagagcctacggttacttggagacacatctctcccaaagcggttggctttgtg
agtgaagacgaatacttggaaattcagggcatcaccagggagcagtcaggggactacgag
tgcagtgcctccaatgacgtggccgcgcccgtggtacggagagtaaaggtcaccgtgaac
tatccaccatacatttcagaagccaagggtacaggtgtccccgtgggacaaaaggggaca
ctgcagtgtgaagcctcagcagtcccctcagcagaattccagtggtacaaggatgacaaa
agactgattgaaggaaagaaaggggtgaaagtggaaaacagacctttcctctcaaaactc
atcttcttcaatgtctctgaacatgactatgggaactacacttgcgtggcctccaacaag
ctgggccacaccaatgccagcatcatgctatttggtccaggcgccgtcagcgaggtgagc
aacggcacgtcgaggagggcaggctgcgtctggctgctgcctcttctggtcttgcacctg
cttctcaaattttga

DBGET integrated database retrieval system