KEGG   Homo sapiens (human): 509Help
Entry
509               CDS       T01001                                 

Gene name
ATP5C1, ATP5C, ATP5CL1
Definition
ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (EC:3.6.1.14)
Orthology
K02136  
F-type H+-transporting ATPase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    509 (ATP5C1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    509 (ATP5C1)
   05012 Parkinson's disease
    509 (ATP5C1)
   05016 Huntington's disease
    509 (ATP5C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p15.1
AA seq 298 aa AA seqDB search
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgcgcgggtgtcgctgggctgtcggcctggaccttgcagccgcaatggatt
caagttcgaaatatggcaactttgaaagatatcaccaggagactaaagtccatcaaaaac
atccagaaaattaccaagtctatgaaaatggtagcggcagcaaaatatgcccgagctgag
agagagctgaaaccagctcgaatatatggattgggatctttagctctgtatgaaaaagct
gatatcaaggggcctgaagacaagaagaaacacctccttattggtgtgtcctcagatcga
ggactgtgtggtgctattcattcctccattgctaaacagatgaaaagcgaggttgctaca
ctaacagcagctgggaaagaagttatgcttgttggaattggtgacaaaatcagaggcata
ctttataggactcattctgaccagtttctggtggcattcaaagaagtgggaagaaagccc
cccacttttggagatgcgtcagtcattgcccttgaattactaaattctggatatgaattt
gatgaaggctccatcatctttaataaattcaggtctgtcatctcctataagacagaagaa
aagcccatcttttcccttaataccgttgcaagtgctgacagcatgagtatctatgacgat
attgatgctgacgtgctgcaaaattaccaagaatacaatctggccaacatcatctactac
tctctgaaggagtccaccactagtgagcagagtgccaggatgacagccatggacaatgcc
agcaagaatgcttctgagatgattgacaaattgacattgacattcaaccgtacccgccaa
gctgtcatcacaaaagagttgattgaaattatctctggtgctgcagctctggattaa

DBGET integrated database retrieval system