KEGG   Homo sapiens (human): 5090Help
Entry
5090              CDS       T01001                                 

Gene name
PBX3
Definition
(RefSeq) PBX homeobox 3
  KO
K15610  
pre-B-cell leukemia transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Network
N00119  
MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5090 (PBX3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, PBC
    5090 (PBX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P40426(Tbio)
UniProt: 
Position
9q33.3
AA seq 434 aa AA seqDB search
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS
LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV
SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH
VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR
NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD
SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS
PTEGPGSVHSDTSN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaatccaggatgctgcagactctggccggggtgaacctggctggccactcg
gtgcaggggggcatggccctgccgcctcccccgcacggccacgaaggggcggacggcgac
ggcaggaagcaggacatcggcgacatcctccaccagatcatgaccatcaccgaccagagc
ttggacgaggcgcaagcaaagaaacatgccctgaactgtcacagaatgaaaccagcgctc
ttcagcgtcctgtgtgagatcaaagagaaaacaggtctcagcatcagaggagcccaggag
gaggaccctcccgatccccagctaatgagactggacaatatgcttttggcagaaggggtt
tcaggtcctgagaaaggtgggggatcggcggcagcagctgcagccgcggcagcctctgga
ggttcttcagataactctattgaacactcagattacagagccaaattgacccagatcaga
caaatctatcacacagaactggagaaatatgaacaggcatgtaatgaatttactacacat
gtgatgaaccttctccgagaacagagtagaacacgtcccatttctccaaaagagattgaa
agaatggtgggcatcatccatcgaaaatttagttccattcagatgcagctcaaacaaagc
acttgtgaagcagttatgattttaagatcaaggttccttgatgccagacggaaaaggcgt
aacttcagtaaacaggccacagaaatcttgaatgaatatttttactcacacctcagcaac
ccctaccccagtgaagaagccaaagaggagctggccaagaaatgcagcatcacagtgtca
caggtatccaattggtttggcaacaaacgaatcaggtacaagaagaacattggcaagttt
caggaagaagccaacctctatgctgcaaagacggccgtgacagctgcacacgcagtagca
gcagctgtgcagaacaaccagaccaattcgcccaccacaccaaattccggttcttctggt
tcttttaacctcccaaattctggggacatgttcatgaacatgcagagtctgaatggggat
tcttaccaagggtcccaagtcggagccaatgtgcaatcacaggtggataccctccgtcat
gttatcaatcagacgggaggctacagtgatggccttggaggaaattcactgtacagtcca
cataatttaaatgctaatggaggctggcaggacgcaacaactccatcttctgtgacttct
cctacagaaggcccaggaagtgtgcactcggatacctctaactaa

DBGET integrated database retrieval system