KEGG   Homo sapiens (human): 5093Help
Entry
5093              CDS       T01001                                 

Gene name
PCBP1, HEL-S-85, HNRPE1, HNRPX, hnRNP-E1, hnRNP-X
Definition
(RefSeq) poly(rC) binding protein 1
  KO
K12889  
poly(rC)-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Ferroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    5093 (PCBP1)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    5093 (PCBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5093 (PCBP1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    5093 (PCBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15365(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 356 aa AA seqDB search
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatgccggtgtgactgaaagtggactaaatgtgactctcaccattcggcttcttatg
cacggaaaggaagtaggaagcatcattgggaagaaaggggagtcggttaagaggatccgc
gaggagagtggcgcgcggatcaacatctcggaggggaattgtccggagagaatcatcact
ctgaccggccccaccaatgccatctttaaggctttcgctatgatcatcgacaagctggag
gaagatatcaacagctccatgaccaacagtaccgcggccagcaggcccccggtcaccctg
aggctggtggtgccggccacccagtgcggctccctgattgggaaaggcgggtgtaagatc
aaagagatccgcgagagtacgggggcgcaggtccaggtggcgggggatatgctgcccaac
tccaccgagcgggccatcaccatcgctggcgtgccgcagtctgtcaccgagtgtgtcaag
cagatttgcctggtcatgctggagacgctctcccagtctccgcaagggagagtcatgacc
attccgtaccagcccatgccggccagctccccagtcatctgcgcgggcggccaagatcgg
tgcagcgacgctgcgggctacccccatgccacccatgacctggagggaccacctctagat
gcctactcgattcaaggacaacacaccatttctccgctcgatctggccaagctgaaccag
gtggcaagacaacagtctcactttgccatgatgcacggcgggaccggattcgccggaatt
gactccagctctccagaggtgaaaggctattgggcaagtttggatgcatctactcaaacc
acccatgaactcaccattccaaataacttaattggctgcataatcgggcgccaaggcgcc
aacattaatgagatccgccagatgtccggggcccagatcaaaattgccaacccagtggaa
ggctcctctggtaggcaggttactatcactggctctgctgccagtattagtctggcccag
tatctaatcaatgccaggctttcctctgagaagggcatggggtgcagctag

DBGET integrated database retrieval system