KEGG   Homo sapiens (human): 50943Help
Entry
50943             CDS       T01001                                 

Gene name
FOXP3, AIID, DIETER, IPEX, PIDX, XPID
Definition
forkhead box P3
Orthology
K10163  
forkhead box P3
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory bowel disease (IBD)
Disease
H00107  
Other well-defined immunodeficiency syndromes
H00512  
Permanent neonatal diabetes mellitus (PNDM)
Class
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 396 aa AA seqDB search
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
LNPMPPSQLQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINV
ASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFL
KHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASS
DKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHN
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccccaggcctggcaagccctcggccccttccttggcccttggcccatcccca
ggagcctcgcccagctggagggctgcacccaaagcctcagacctgctgggggcccggggc
ccagggggaaccttccagggccgagatcttcgaggcggggcccatgcctcctcttcttcc
ttgaaccccatgccaccatcgcagctgcagctctcaacggtggatgcccacgcccggacc
cctgtgctgcaggtgcaccccctggagagcccagccatgatcagcctcacaccacccacc
accgccactggggtcttctccctcaaggcccggcctggcctcccacctgggatcaacgtg
gccagcctggaatgggtgtccagggagccggcactgctctgcaccttcccaaatcccagt
gcacccaggaaggacagcaccctttcggctgtgccccagagctcctacccactgctggca
aatggtgtctgcaagtggcccggatgtgagaaggtcttcgaagagccagaggacttcctc
aagcactgccaggcggaccatcttctggatgagaagggcagggcacaatgtctcctccag
agagagatggtacagtctctggagcagcagctggtgctggagaaggagaagctgagtgcc
atgcaggcccacctggctgggaaaatggcactgaccaaggcttcatctgtggcatcatcc
gacaagggctcctgctgcatcgtagctgctggcagccaaggccctgtcgtcccagcctgg
tctggcccccgggaggcccctgacagcctgtttgctgtccggaggcacctgtggggtagc
catggaaacagcacattcccagagttcctccacaacatggactacttcaagttccacaac
atgcgaccccctttcacctacgccacgctcatccgctgggccatcctggaggctccagag
aagcagcggacactcaatgagatctaccactggttcacacgcatgtttgccttcttcaga
aaccatcctgccacctggaagaacgccatccgccacaacctgagtctgcacaagtgcttt
gtgcgggtggagagcgagaagggggctgtgtggaccgtggatgagctggagttccgcaag
aaacggagccagaggcccagcaggtgttccaaccctacacctggcccctga

DBGET integrated database retrieval system