KEGG   Homo sapiens (human): 50944Help
Entry
50944             CDS       T01001                                 

Gene name
SHANK1, SPANK-1, SSTRIP, synamon
Definition
SH3 and multiple ankyrin repeat domains 1
Orthology
K15009  
SH3 and multiple ankyrin repeat domains protein
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Class
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 2161 aa AA seqDB search
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPRGTRGQGSGAPGSLASVRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LFNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGADKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGTGLTVPPALLRANSDTSMALPDWMVFSAPGAASSGAPGPTSGSQGQSQPSAPTTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQESKQESRSDKAKRLFRHYTVGSYDSFDAPSLMDGIGPGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPP
TISLRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPG
PGGLASLGKHRPKGFFATESSFDPHHRAQPSYERPSFLPPGPGLMLRQKSIGAAEDDRPY
LAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPVPSSSGRLTPSPRGGPFNPGSGG
PLPASSPASFDGPSPPDTRVGSREKSLYHSGPLPPAHHHPPHHHHHHAPPPQPHHHHAHP
PHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTPGAPSPSHHGSAGGGGGSSQGP
ALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGGGLPPAPSPTSPASPQP
PPAVAAPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPEPTGGGGGGGSSPSP
APAMSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTLFLST
DAGDEDGGDGGLGTGAAPGPRLRHSKSIDEGMFSAEPYLRLESAGSGAGYGGYGAGSRAY
GGGGGSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGAPQPPPRP
PSPRYEAPPPTPHHHSPHAHHEPVLRLWGASPPDPARRELGYRAGLGSQEKSLPASPPAA
RRSLLHRLPPTAPGVGPLLLQLGTEPPAPHPGVSKPWRSAAPEEPERLPLHVRFLENCQP
RAPVTSGRGPPSEDGPGVPPPSPRRSVPPSPTSPRASEENGLPLLVLPPPAPSVDVEDGE
FLFVEPLPPPLEFSNSFEKPESPLTPGPPHPLPDTPAPATPLPPVPPPAVAAAPPTLDST
ASSLTSYDSEVATLTQGASAAPGDPHPPGPPAPAAPAPAAPQPGPDPPPGTDSGIEEVDS
RSSSDHPLETISSASTLSSLSAEGGGSAGGGGGAGAGVASGPELLDTYVAYLDGQAFGGS
STPGPPYPPQLMTPSKLRGRALGASGGLRPGPSGGLRDPVTPTSPTVSVTGAGTDGLLAL
RACSGPPTAGVAGGPVAVEPEVPPVPLPTASSLPRKLLPWEEGPGPPPPPLPGPLAQPQA
SALATVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQ
RQRLSDDSQSSLLSKPVSSLFQNWPKPPLPPLPTGTGVSPTAAAAPGATSPSASSSSTST
RHLQGVEFEMRPPLLRRAPSPSLLPASEHKVSPAPRPSSLPILPSGPLYPGLFDIRGSPT
GGAGGSADPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKPLGFWTK
FDVADWLEWLGLAEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLE
R
NT seq 6486 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagccccgcgacaagcgaggacgaggaacgccacagtgccagcgagtgtccc
gaggggggctcagagtccgacagctccccagacgggccaggtcgaggcccccgggggacc
cggggccagggcagtggggcacctggtagcctggcctctgttagaggcctccagggccgc
tcaatgtccgtcccagacgacgcccacttcagcatgatggtcttcaggattggcatcccg
gacctgcaccagacaaaatgccttcgcttcaaccccgatgccaccatctggacggccaag
cagcaggtgctctgtgccctgagcgagagcctgcaggatgtgctcaactatggcctgttc
caaccggccacctccggccgcgatgccaacttcctggaggaggagaggctgctgcgggag
tacccccagtcctttgagaagggggtcccctacctggagttccgatacaagacccgagtt
tacaaacagaccaacctggatgagaagcagctggccaagttgcacacgaagacggggttg
aagaagttcctggagtatgtgcagctcgggacatctgacaaggtggcgcggctgctggac
aaggggctggaccccaattaccatgactcggattcgggagagacccccttgacactggcg
gcccagaccgaaggctctgtagaggtgattcgaaccctgtgcctgggcggggcccacatt
gacttccgggcccgggatggcatgaccgcactgcataaggccgcatgcgcccgacactgc
ctggcactcacggcgctcctggaccttgggggttcccccaactacaaggaccgtcggggg
ctgacccctctgttccacacggccatggtgggtggtgacccccgatgctgcgagctgctc
ctgttcaacagggcccagctgggcatagctgatgagaacggctggcaggaaatccaccag
gcctgccagcggggtcactctcagcacctggagcatctgcttttctacggggctgagcct
ggagcccagaacgcctcggggaacacggctctgcacatctgcgccctctacaacaaggag
acctgtgccaggatcctcctgtatcgaggtgccgacaaggatgtgaagaacaacaacgga
cagacccccttccaggtggcagtgattgctgggaattttgagctgggggagctgatccga
aaccaccgagaacaggatgtggtgcccttccaggagtcccccaagtacgcggcccggcga
cgggggcccccaggcacagggctgacggtgcccccggcgctgctgcgggccaacagtgac
accagcatggcgctgcccgactggatggtgttctccgccccgggggccgcgtcctctggg
gcccctggccctacctcagggtcccagggccagtcgcagccctcggcccccaccaccaag
ctcagcagcgggaccctccgaagtgccagcagcccccggggtgccagggcccgctctcca
tcccgagggaggcaccctgaggacgccaagaggcagccccgaggccggcccagctccagc
gggacaccccgggaagggccagccgggggcacggggggctcagggggccccgggggctcc
ctgggcagccgcgggaggcggaggaagctctactcagcggtacccggacgctccttcatg
gctgtgaagtcctaccaggcccaagccgagggggagatctccctgagcaagggcgagaag
atcaaagtacttagcatcggggaaggaggcttctgggaaggccaggtcaaaggtcgtgtt
ggctggttcccctctgactgcctggaagaagtggcgaatcgctctcaggagagcaagcaa
gaaagccgcagtgacaaggcaaagagactcttccggcattataccgtgggctcctacgac
agctttgatgccccaagcttaatggatgggattggcccagggagcgattacatcattaag
gagaagacagtcttgctgcagaagaaggacagtgaggggtttgggttcgtgctccggggg
gccaaggcgcagacccccatcgaggagttcacccccaccccggccttcccggcgctgcag
tacctggagtcggtggacgagggtggcgtggcatggcgagctggactgcgaatgggagac
ttcctcatcgaggtgaacgggcagaatgtggtgaaggtcggccaccgacaggtggtgaac
atgatccgccaagggggcaacacgctgatggtgaaggtggtgatggtcaccaggcacccg
gacatggatgaggcagtgcacaagaaagcaccccagcaggccaagcggctgccgccccca
accatctccctgcgttccaaatctatgacctcagagctggaggagatggagtacgagcag
cagccggcgccggtgcccagcatggagaaaaagcggaccgtgtatcagatggctctcaac
aaactggacgaaatcctggccgcagctcaacagaccatcagtgcaagcgaaagccctggt
cccggtggcctcgcgtccctgggcaaacaccgacccaaaggtttctttgccactgagtcg
agcttcgatccccaccaccgtgcccagccaagttacgagcgtccttctttcctgcctcca
ggacctgggttgatgctccggcaaaaatctatcggtgcggcagaagatgacagaccttac
ctagcacccccagccatgaaattcagccgcagcctgtctgtgcctggttcggaggacatt
cccccgccacccaccacgtccccaccggagcctccctacagcacacctccagtcccctcc
tcctcagggcgcctcaccccctcccctcggggagggcccttcaaccctggctctggtggc
cccctccccgcctcctcccctgcatcctttgacgggccctcccctcccgacactcgcgtg
gggagccgcgagaagagcctgtaccacagtgggcccctgcccccggcccaccaccacccg
ccccaccaccaccaccaccacgccccgccccctcagccccaccaccaccacgcccacccc
cctcatcctcccgagatggagacaggcggctctcccgacgaccctccaccccgcctggct
ctggggccccagcccagcctgcgaggctggaggggcggcgggcccagcccgaccccgggg
gccccgtccccatcgcaccacggcagcgcgggcgggggcggcggctcctcccagggcccg
gctctacgctatttccagctgcccccgcgggcggccagcgcagccatgtacgtgcccgcc
cgctcgggccgcggccgcaagggcccgctggtcaagcagaccaaggtggaaggcgagccc
cagaagggcggcggcctcccgcccgcgccgtcgcccacgtccccggcctccccgcagccg
ccgcccgccgtggccgcgccctcggagaagaactccatccccatccccaccatcatcatc
aaggccccgtccaccagtagcagcggccgcagcagccagggcagcagcaccgaggcggag
ccccccacccagccggagcccacgggaggcggcggcggcggcggctcctcgcccagcccc
gccccggccatgtcacccgtgcccccgtccccctcgcccgtgcccacccccgcctcgccc
agcggcccggccacgctggacttcacgagccagttcggggccgccctggtgggggcggcc
cggagggaggggggctggcagaatgaggcgcgccggcgctccacgctgttcctgtccacc
gacgcgggggacgaggacggcggggacggcgggctgggcacaggggcggccccgggcccg
cggctgcgccactccaaatccatcgacgagggcatgttctccgccgagccctacctccga
ctggagtctgcgggcagcggcgcgggctacggcggctacggggccggtagccgagcctac
gggggtggcgggggcagcagcgccttcaccagcttcctgcccccgcgacccctggtgcac
ccgctgaccggcaaggccctggatcccgcctccccgctggggctggccctggccgcccgc
gagcgagcgctgaaggagtcctcggagggcggcggggccccccagccgcctcccaggccc
ccatcgccccgctacgaggccccgccgcccaccccgcaccaccactcgccccacgcccac
cacgagccagtgctgcgtctctggggggcctccccgccggaccctgcgcgccgggagctg
gggtacagggccgggctgggcagccaggagaagtcccttcccgccagcccgcccgccgcc
cggcgttccctgctacaccgcctgccgcccaccgctcccggggtggggcccctcctgctg
cagctggggacggagcccccggccccgcaccccggagtaagcaagccctggaggtccgca
gcccccgaagaacccgagcggctgccgctgcacgtgcggttccttgaaaactgccagccc
cgggcccctgtgacgagcggaaggggtcccccctcggaggacgggccgggggtcccgccg
cccagcccacgccggtccgtgcccccctccccgacctccccgagggccagcgaagagaac
gggctgcccctgctggtcctgccgcctcccgccccctcggtggatgtggaagatggcgaa
ttccttttcgtggaaccgctgcctccgcctctggaattctccaacagcttcgaaaagcca
gagtcgcccctcacgcctgggcctccccacccgctgcccgacacacctgcccctgccacc
ccgttaccccctgtgccacccccggctgtggccgcagcccctcccaccctggactccacc
gcatccagcctgacatcctatgacagcgaggtggccaccctgacccagggggcctccgcc
gctcctggggacccccatccaccaggcccgcctgccccagcagcaccggctcccgctgcc
ccacagcctggcccggaccctccgcctggcacggattctggcatcgaggaggtggacagt
cggagcagcagtgaccacccactggagaccatcagcagcgcctccacgctgagcagccta
tctgccgaaggtggtggcagcgcagggggtgggggcggggctggggccggtgtggccagt
gggccggagcttctggacacctatgtggcctacctggacggccaggcctttgggggcagc
agtactcccggcccgccataccctcctcagctcatgactccctctaagctccggggccgg
gcgctaggagccagcggaggcctgcggcctggccccagcgggggactccgagaccctgtt
acccccaccagccccaccgtctcggtgacaggggctggaaccgatgggctgctggccctg
cgtgcttgttcaggaccccccacggcaggcgtggcggggggtccggtggctgtagagcca
gaagtcccaccggtgcccttgccgacggcctcctctctgccccggaagctgctgccctgg
gaggagggcccgggcccaccgccaccacctctgcccgggcccttggcccagcctcaggcc
tcagccttggccacagtaaaagccagcatcatcagtgaactcagctccaagcttcagcag
tttgggggctcctcggcagctggcggcgctctgccctgggcccgaggaggcagtggggga
ggcggagacagccaccacgggggagccagctatgtccccgagaggacctcctccctgcag
cggcagagactctccgacgactcccagtcctcactcctctccaagcctgtcagcagcctg
tttcagaactggcccaaaccacctctgccgccactccccaccggaacaggggtctcccct
acagccgctgcggccccaggggccacctcaccctcagcctcctcctcctccacgtccacc
cgccacctccagggcgtggagttcgagatgcggccccctctgctccgccgggcccccagc
ccctcgctgctgcccgcctcggagcacaaggtcagccctgcgcccaggccctcgtccctg
cccatcctgccttccggacccctctacccaggcctctttgacatccgtggctccccaact
ggaggggcaggaggctcggctgaccccttcgccccagtctttgtgccgccacacccgggg
atatccggggggctcgggggagccttgtcaggggcctcgcgctccctctcaccgacccgc
ctgctctcgctgcccccggacaagccgtttggcgctaaacctctggggttctggaccaag
ttcgacgtggctgattggctggagtggctgggtttggcggagcaccgagcccagttcctg
gaccacgagatcgatggctcccacctgcccgccttgaccaaggaggactacgtcgatcta
ggtgtgaccagggtgggccaccgcatgaacatcgaccgggctctcaaattcttcctggag
aggtga

DBGET integrated database retrieval system