KEGG   Homo sapiens (human): 5096Help
Entry
5096              CDS       T01001                                 

Gene name
PCCB
Definition
(RefSeq) propionyl-CoA carboxylase beta subunit
  KO
K01966  
propionyl-CoA carboxylase beta chain [EC:6.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Disease
H00175  
Propionic acidemia
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    5096 (PCCB)
   00640 Propanoate metabolism
    5096 (PCCB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    5096 (PCCB)
Enzymes [BR:hsa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     5096 (PCCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P05166(Tbio)
UniProt: 
Position
3q22.3
AA seq 539 aa AA seqDB search
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHK
RGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVY
VFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVT
QEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVP
ELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE
AAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcattacgggtggcggcggtcggggcaaggctcagcgttctggcgagcggt
ctccgcgccgcggtccgcagcctttgcagccaggccacctctgttaacgaacgcatcgaa
aacaagcgccggaccgcgctgctgggagggggccaacgccgtattgacgcgcagcacaag
cgaggaaagctaacagccagggagaggatcagtctcttgctggaccctggcagctttgtt
gagagcgacatgtttgtggaacacagatgtgcagattttggaatggctgctgataagaat
aagtttcctggagacagcgtggtcactggacgaggccgaatcaatggaagattggtttat
gtcttcagtcaggattttacagtttttggaggcagtctgtcaggagcacatgcccaaaag
atctgcaaaatcatggaccaggccataacggtgggggctccagtgattgggctgaatgac
tctgggggagcacggatccaagaaggagtggagtctttggctggctatgcagacatcttt
ctgaggaatgttacggcatccggagtcatccctcagatttctctgatcatgggcccatgt
gctggtggggccgtctactccccagccctaacagacttcacgttcatggtaaaggacacc
tcctacctgttcatcactggccctgatgttgtgaagtctgtcaccaatgaggatgttacc
caggaggagctcggtggtgccaagacccacaccaccatgtcaggtgtggcccacagagct
tttgaaaatgatgttgatgccttgtgtaatctccgggatttcttcaactacctgcccctg
agcagtcaggacccggctcccgtccgtgagtgccacgatcccagtgaccgtctggttcct
gagcttgacacaattgtccctttggaatcaaccaaagcctacaacatggtggacatcata
cactctgttgttgatgagcgtgaattttttgagatcatgcccaattatgccaagaacatc
attgttggttttgcaagaatgaatgggaggactgttggaattgttggcaaccaacctaag
gtggcctcaggatgcttggatattaattcatctgtgaaaggggctcgttttgtcagattc
tgtgatgcattcaatattccactcatcacttttgttgatgtccctggctttctacctggc
acagcacaggaatacgggggcatcatccggcatggtgccaagcttctctacgcatttgct
gaggcaactgtacccaaagtcacagtcatcaccaggaaggcctatggaggtgcctatgat
gtcatgagctctaagcacctttgtggtgataccaactatgcctggcccaccgcagagatt
gcagtcatgggagcaaagggcgctgtggagatcatcttcaaagggcatgagaatgtggaa
gctgctcaggcagagtacatcgagaagtttgccaaccctttccctgcagcagtgcgaggg
tttgtggatgacatcatccaaccttcttccacacgtgcccgaatctgctgtgacctggat
gtcttggccagcaagaaggtacaacgtccttggagaaaacatgcaaatattccattgtaa

DBGET integrated database retrieval system