KEGG   Homo sapiens (human): 5096Help
Entry
5096              CDS       T01001                                 

Gene name
PCCB
Definition
(RefSeq) propionyl-CoA carboxylase beta subunit (EC:6.4.1.3)
  KO
K01966  
propionyl-CoA carboxylase beta chain [EC:6.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Disease
H00175  
Propionic acidemia
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5096 (PCCB)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    5096 (PCCB)
   00640 Propanoate metabolism
    5096 (PCCB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    5096 (PCCB)
Enzymes [BR:hsa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     5096 (PCCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21-q22
AA seq 539 aa AA seqDB search
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHK
RGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVY
VFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVT
QEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVP
ELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE
AAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcattacgggtggcggcggtcggggcaaggctcagcgttctggcgagcggt
ctccgcgccgcggtccgcagcctttgcagccaggccacctctgttaacgaacgcatcgaa
aacaagcgccggaccgcgctgctgggagggggccaacgccgtattgacgcgcagcacaag
cgaggaaagctaacagccagggagaggatcagtctcttgctggaccctggcagctttgtt
gagagcgacatgtttgtggaacacagatgtgcagattttggaatggctgctgataagaat
aagtttcctggagacagcgtggtcactggacgaggccgaatcaatggaagattggtttat
gtcttcagtcaggattttacagtttttggaggcagtctgtcaggagcacatgcccaaaag
atctgcaaaatcatggaccaggccataacggtgggggctccagtgattgggctgaatgac
tctgggggagcacggatccaagaaggagtggagtctttggctggctatgcagacatcttt
ctgaggaatgttacggcatccggagtcatccctcagatttctctgatcatgggcccatgt
gctggtggggccgtctactccccagccctaacagacttcacgttcatggtaaaggacacc
tcctacctgttcatcactggccctgatgttgtgaagtctgtcaccaatgaggatgttacc
caggaggagctcggtggtgccaagacccacaccaccatgtcaggtgtggcccacagagct
tttgaaaatgatgttgatgccttgtgtaatctccgggatttcttcaactacctgcccctg
agcagtcaggacccggctcccgtccgtgagtgccacgatcccagtgaccgtctggttcct
gagcttgacacaattgtccctttggaatcaaccaaagcctacaacatggtggacatcata
cactctgttgttgatgagcgtgaattttttgagatcatgcccaattatgccaagaacatc
attgttggttttgcaagaatgaatgggaggactgttggaattgttggcaaccaacctaag
gtggcctcaggatgcttggatattaattcatctgtgaaaggggctcgttttgtcagattc
tgtgatgcattcaatattccactcatcacttttgttgatgtccctggctttctacctggc
acagcacaggaatacgggggcatcatccggcatggtgccaagcttctctacgcatttgct
gaggcaactgtacccaaagtcacagtcatcaccaggaaggcctatggaggtgcctatgat
gtcatgagctctaagcacctttgtggtgataccaactatgcctggcccaccgcagagatt
gcagtcatgggagcaaagggcgctgtggagatcatcttcaaagggcatgagaatgtggaa
gctgctcaggcagagtacatcgagaagtttgccaaccctttccctgcagcagtgcgaggg
tttgtggatgacatcatccaaccttcttccacacgtgcccgaatctgctgtgacctggat
gtcttggccagcaagaaggtacaacgtccttggagaaaacatgcaaatattccattgtaa

DBGET integrated database retrieval system