KEGG   Homo sapiens (human): 51Help
Entry
51                CDS       T01001                                 

Gene name
ACOX1, ACOX, PALMCOX, SCOX
Definition
(RefSeq) acyl-CoA oxidase 1, palmitoyl (EC:1.3.3.6)
  KO
K00232  
acyl-CoA oxidase [EC:1.3.3.6]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
cAMP signaling pathway
Peroxisome
Module
beta-Oxidation
Disease
H00407  
Peroxisomal beta-oxidation enzyme deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    51 (ACOX1)
  Lipid metabolism
   00071 Fatty acid degradation
    51 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    51 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    51 (ACOX1)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    51 (ACOX1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    51 (ACOX1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    51 (ACOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     51 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 660 aa AA seqDB search
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRY
EVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATAEQQ
ERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL
KMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA
IRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIG
QGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSP
ESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFS
EKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIR
SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggacctgcgcagggagcgggattccgccagcttcaacccggagctgcttaca
cacatcctggacggcagccccgagaaaacccggcgccgccgagagatcgagaacatgatc
ctgaacgacccagacttccagcatgaggacttgaacttcctcactcgcagccagcgttat
gaggtggctgtcaggaaaagtgccatcatggtgaagaagatgagggagtttggcatcgct
gaccctgatgaaattatgtggtttaaaaattttgtgcaccgagggcggcctgagcctctg
gatcttcacttgggcatgttcctgcccaccttgcttcaccaggcaactgcggagcagcag
gagcgcttcttcatgcccgcctggaacttggagatcattggcacttatgcccagacagag
atgggtcatggaactcaccttcgaggcttggaaaccacagccacgtatgaccctgaaacc
caggagttcattctcaacagtcctactgtgacctccattaaatggtggcctggtgggctt
ggaaagacttcaaatcatgcaatagttcttgcccagctcatcactaaggggaaatgctat
ggattacatgcctttatcgtacctattcgtgaaatcgggacccataagcctttgccagga
attaccgttggtgacatcggccccaaatttggttatgatgagatagacaatggctacctc
aaaatggacaaccatcgtattcccagagaaaacatgctgatgaagtatgcccaggtgaag
cctgatggcacatacgtgaaaccgctgagtaacaagctgacttacgggaccatggtgttt
gtcaggtccttccttgtgggagaagctgctcgggctctgtctaaggcgtgcaccattgcc
atccgatacagcgctgtgaggcaccagtctgaaatcaagccaggtgaaccagaaccacag
attttggattttcaaacccagcagtataaactctttccactcctggccactgcctatgcc
ttccagtttgtgggcgcatacatgaaggagacctatcaccggattaacgaaggcattggt
caaggggacctgagtgaactgcctgagcttcatgccctcaccgctggactgaaggctttc
acctcctggactgcaaacactggcattgaagcatgtcggatggcttgtggtgggcatggc
tattctcattgcagtggtcttccaaatatttatgtcaatttcaccccaagctgtaccttt
gagggagaaaacactgtcatgatgctccagacggctaggttcctgatgaaaagttatgat
caggtgcactcaggaaagttggtgtgtggcatggtgtcctatttgaacgacctgcccagt
cagcgcatccagccacagcaggtagcagtctggccaaccatggtggatatcaacagcccc
gaaagcctaaccgaagcatataaactccgtgcagccagattagtagaaattgctgcaaaa
aaccttcaaaaagaagtgattcacagaaaaagcaaggaggtagcttggaacctaacttct
gttgaccttgttcgagcaagtgaggcacattgccactatgtggtagttaagctcttttca
gaaaaactcctcaaaattcaagataaagccattcaagctgtcttaaggagtttatgtctg
ctgtattctctgtatggaatcagtcagaacgcgggggatttccttcaggggagcatcatg
acagagcctcagattacacaagtaaaccagcgtgtaaaggagttactcactctgattcgc
tcagatgctgttgctttggttgatgcatttgattttcaggatgtgacacttggctctgtg
cttggccgctatgatgggaatgtgtatgaaaacttgtttgagtgggctaagaactcccca
ctgaacaaagcagaggtccacgaatcttacaagcacctgaagtcactgcagtccaagctc
tga

DBGET integrated database retrieval system