KEGG   Homo sapiens (human): 51010Help
Entry
51010             CDS       T01001                                 

Gene name
EXOSC3, CGI-102, PCH1B, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10
Definition
(RefSeq) exosome component 3
  KO
K03681  
exosome complex component RRP40
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    51010 (EXOSC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     51010 (EXOSC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p11
AA seq 275 aa AA seqDB search
MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARAC
SRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGI
VTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVC
IDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVK
AKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacctgcgtctgtcgcggctgaatctctcgcgggcagcagggcgcgcgctgca
cgcacagtactaggtcaggtggtgctcccgggtgaggagctgctcctgccggaacaggag
gacgcggaaggccctgggggtgcagtggagcgaccgttgagcctgaatgctagagcgtgc
tcgcgggtgcgcgttgtatgcggtccgggccttcggcgctgtggggaccgcctgctggtc
accaagtgcggccgcctccgtcacaaggagcccggcagtggcagcggcggcggtgtttac
tgggtggactctcagcagaagcggtatgttccagtaaaaggagaccatgtgattggcata
gtgacagctaaatctggagatatattcaaagttgatgttggagggagtgagccagcttct
ttgtcttacttgtcatttgaaggtgcaactaaaagaaacagaccaaatgtgcaggttgga
gatctcatctatggccagtttgtggttgctaataaagacatggaaccagagatggtctgt
attgacagctgtggacgagccaatggaatgggtgtcattggacaggatggtctgcttttt
aaagtgactctgggcttaattagaaagctattagctccagattgtgaaatcatacaggaa
gtgggaaaactctatccactggagatagtatttggaatgaatggaagaatatgggttaag
gcaaaaaccatccagcagactttaattttggcaaacattttagaagcttgtgaacacatg
acgtcagatcaaagaaaacagatcttctccagattggcagaaagttga

DBGET integrated database retrieval system