KEGG   Homo sapiens (human): 51021Help
Entry
51021             CDS       T01001                                 

Gene name
MRPS16, COXPD2, MRP-S16, RPMS16
Definition
mitochondrial ribosomal protein S16
Orthology
K02959  
small subunit ribosomal protein S16
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    51021 (MRPS16)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    51021 (MRPS16)
  Bacteria
    51021 (MRPS16)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    51021 (MRPS16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 137 aa AA seqDB search
MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS
HGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL
ASQKTDAEATDTEATET
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcactactctcctctgcaaggcctaccgtgggggccacttaaccatccgc
cttgccctgggtggctgcaccaatcggccgttctaccgcattgtggctgctcacaacaag
tgtcccagggatggccgtttcgtagagcagctgggctcctatgatccattgcccaacagt
catggagaaaaactcgttgccctcaacctagacaggatccgtcattggattggctgcggg
gcccacctctctaagcctatggaaaagcttctgggtcttgctggctttttccctctgcat
cctatgatgatcacaaatgctgagagactgcgaaggaaacgggcacgtgaagtcctgtta
gcttctcagaaaacagatgcagaagctacagatacagaggctacagaaacataa

DBGET integrated database retrieval system