KEGG   Homo sapiens (human): 51024Help
Entry
51024             CDS       T01001                                 

Gene name
FIS1, CGI-135, TTC11
Definition
(RefSeq) fission, mitochondrial 1
  KO
K17969  
mitochondrial fission 1 protein
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    51024 (FIS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 152 aa AA seqDB search
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtgctgaacgagctggtgtctgtggaggacctgctgaagtttgaaaagaaa
tttcagtctgagaaggcagcaggctcggtgtccaagagcacgcagtttgagtacgcctgg
tgcctggtgcggagcaagtacaatgatgacatccgtaaaggcatcgtgctgctcgaggag
ctgctgcccaaagggagcaaggaggaacagcgggattacgtcttctacctggccgtgggg
aactaccggctcaaggaatacgagaaggccttaaagtacgtccgcgggttgctgcagaca
gagccccagaacaaccaggccaaggaactggagcggctcattgacaaggccatgaagaaa
gatggactcgtgggcatggccatcgtgggaggcatggccctgggtgtggcgggactggcc
ggactcatcggacttgctgtgtccaagtccaaatcctga

DBGET integrated database retrieval system