KEGG   Homo sapiens (human): 51028Help
Entry
51028             CDS       T01001                                 

Gene name
VPS36, C13orf9, CGI-145, EAP45
Definition
(RefSeq) vacuolar protein sorting 36 homolog
  KO
K12190  ESCRT-II complex subunit VPS36
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Module
hsa_M00410  ESCRT-II complex
Network
N00183  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    51028 (VPS36)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    51028 (VPS36)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   51028 (VPS36)
  Exosomal proteins of colorectal cancer cells
   51028 (VPS36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EAP30 Vps36_ESCRT-II MA3 GRAM TTRAP PH_TFIIH
Motif
Other DBs
NCBI-GeneID: 51028
NCBI-ProteinID: NP_057159
OMIM: 610903
HGNC: 20312
Ensembl: ENSG00000136100
Vega: OTTHUMG00000016964
Pharos: Q86VN1(Tbio)
UniProt: Q86VN1
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 386 aa AA seqDB search
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMA
ILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYR
RLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcttcgtttggaccagcggcctcctggagatcaacgagaccctggtgatccag
cagcgcggggtgcgaatctacgatggcgaggagaagataaaatttgatgctgggactctc
cttcttagtacacaccgactgatttggagagatcagaaaaatcatgagtgttgcatggcc
attctcctttcccaaattgtgttcattgaagaacaggcggctggaattgggaagagtgcc
aaaatagtggttcatcttcacccagctcctcctaacaaagaacctggcccattccagagt
agtaagaactcctacatcaaactctccttcaaagaacatggccagattgagttttacagg
cgtttatcagaggaaatgacacaaagaagatgggagaatatgccagtttcccagtcatta
caaacaaatagaggaccccagccaggaagaataagggctgtaggaattgtaggtattgaa
aggaaactggaagaaaaaagaaaagaaactgacaaaaacatttctgaggcctttgaagac
ctcagcaaactaatgatcaaggctaaggaaatggtggaattatcaaaatcaattgctaat
aaaattaaagacaaacaaggtgacatcacagaagatgagaccatcaggtttaaatcctac
ttgctgagcatgggaatagctaacccagttaccagagaaacctacggctcaggcacacag
taccacatgcagctggccaaacaactggctggaatattgcaggtgcctttagaggaacga
gggggaataatgtcactcacggaggtgtactgcttagtaaaccgagctcgaggaatggaa
ttgctctcaccagaagatttagtgaatgcgtgcaagatgctggaagcactgaaattacct
ctcaggctccgtgtgtttgacagtggcgtcatggtaattgagcttcagtctcacaaggaa
gaggaaatggtggcctcggccctggagacagtttcagaaaagggatccctaacatcagaa
gagtttgctaagcttgtgggaatgtctgtcctcctagccaaagaaaggttgctgcttgca
gagaagatgggccatctttgccgtgatgactcagtggaaggcctgcgtttttacccaaat
ttatttatgacacagagctaa

DBGET integrated database retrieval system