KEGG   Homo sapiens (human): 51028Help
Entry
51028             CDS       T01001                                 

Gene name
VPS36, C13orf9, EAP45
Definition
vacuolar protein sorting 36 homolog (S. cerevisiae)
Orthology
K12190  
ESCRT-II complex subunit VPS36
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-II complex
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 377 aa AA seqDB search
MDRFVWTSGLLEINETLVIQQRGIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFI
EEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQR
RWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAK
EMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQL
AGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSG
VMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRD
DSVEGLRFYPNLFMTQS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcttcgtttggaccagcggcctcctggagatcaacgagaccctggtgatccag
cagcgcgggataaaatttgatgctgggactctccttcttagtacacaccgactgatttgg
agagatcagaaaaatcatgagtgttgcatggccattctcctttcccaaattgtgttcatt
gaagaacaggcggctggaattgggaagagtgccaaaatagtggttcatcttcacccagct
cctcctaacaaagaacctggcccattccagagtagtaagaactcctacatcaaactctcc
ttcaaagaacatggccagattgagttttacaggcgtttatcagaggaaatgacacaaaga
agatgggagaatatgccagtttcccagtcattacaaacaaatagaggaccccagccagga
agaataagggctgtaggaattgtaggtattgaaaggaaactggaagaaaaaagaaaagaa
actgacaaaaacatttctgaggcctttgaagacctcagcaaactaatgatcaaggctaag
gaaatggtggaattatcaaaatcaattgctaataaaattaaagacaaacaaggtgacatc
acagaagatgagaccatcaggtttaaatcctacttgctgagcatgggaatagctaaccca
gttaccagagaaacctacggctcaggcacacagtaccacatgcagctggccaaacaactg
gctggaatattgcaggtgcctttagaggaacgagggggaataatgtcactcacggaggtg
tactgcttagtaaaccgagctcgaggaatggaattgctctcaccagaagatttagtgaat
gcgtgcaagatgctggaagcactgaaattacctctcaggctccgtgtgtttgacagtggc
gtcatggtaattgagcttcagtctcacaaggaagaggaaatggtggcctcggccctggag
acagtttcagaaaagggatccctaacatcagaagagtttgctaagcttgtgggaatgtct
gtcctcctagccaaagaaaggttgctgcttgcagagaagatgggccatctttgccgtgat
gactcagtggaaggcctgcgtttttacccaaatttatttatgacacagagctaa

DBGET integrated database retrieval system