KEGG   Homo sapiens (human): 5104Help
Entry
5104              CDS       T01001                                 

Gene name
SERPINA5, PAI-3, PAI3, PCI, PCI-B, PLANH3, PROCI
Definition
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5
Orthology
K03913  
protein C inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5104 (SERPINA5)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
  5104 (SERPINA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.1
AA seq 406 aa AA seqDB search
MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAA
PSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQ
PRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQT
KGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSRED
QYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLE
LYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGT
RAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcttcctcctcttgtgcctggtgcttctcagccctcagggggcctcccttcac
cgccaccacccccgggagatgaagaagagagtcgaggacctccatgtaggtgccacggtg
gcccccagcagcagaagggactttacctttgacctctacagggccttggcttccgctgcc
cccagccagagcatcttcttctcccctgtgagcatctccatgagcctggccatgctctcc
ctgggggctgggtccagcacaaagatgcagatcctggagggcctgggcctcaacctccag
aaaagctcagagaaggagctgcacagaggctttcagcagctccttcaggaactcaaccag
cccagagatggcttccagctgagcctcggcaatgcccttttcaccgacctggtggtagac
ctgcaggacaccttcgtaagtgccatgaagacgctgtacctggcagacactttccctacc
aactttagggactctgcaggggccatgaagcagatcaatgattatgtggcaaagcaaacg
aagggcaagattgtggacttgcttaagaacctcgatagcaatgcggtcgtgatcatggtg
aattacatcttctttaaagctaagtgggagacaagcttcaaccacaaaggcacccaagag
caagacttctacgtgacctcggagactgtggtgcgggtacccatgatgagccgcgaggat
cagtatcactacctcctggaccggaacctctcctgcagggtggtgggggtcccctaccaa
ggcaatgccacggctttgttcattctccccagtgagggaaagatgcagcaggtggagaat
ggactgagtgagaaaacgctgaggaagtggcttaagatgttcaaaaagaggcagctcgag
ctttaccttcccaaattctccattgagggctcctatcagctggagaaagtcctccccagt
ctggggatcagtaacgtcttcacctcccatgctgatctgtccggcatcagcaaccactca
aatatccaggtgtctgagatggtgcacaaagctgtggtggaggtggacgagtcgggaacc
agagcagcggcagccacggggacaatattcactttcaggtcggcccgcctgaactctcag
aggctagtgttcaacaggccctttctgatgttcattgtggataacaacatcctcttcctt
ggcaaagtgaaccgcccctga

DBGET integrated database retrieval system