KEGG   Homo sapiens (human): 51056Help
Entry
51056             CDS       T01001                                 

Gene name
LAP3, HEL-S-106, LAP, LAPEP, PEPS
Definition
(RefSeq) leucine aminopeptidase 3 (EC:3.4.11.5 3.4.11.1)
  KO
K11142  
cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    51056 (LAP3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    51056 (LAP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     51056 (LAP3)
    3.4.11.5  prolyl aminopeptidase
     51056 (LAP3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   51056 (LAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.32
AA seq 519 aa AA seqDB search
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgctgcctcttccggctgcggggcgagtagtcgtccgacgtctggccgtgaga
cgtttcgggagccggagtctctccaccgcagacatgacgaagggccttgttttaggaatc
tattccaaagaaaaagaagatgatgtgccacagttcacaagtgcaggagagaattttgat
aaattgttagctggaaagctgagagagactttgaacatatctggaccacctctgaaggca
gggaagactcgaaccttttatggtctgcatcaggacttccccagcgtggtgctagttggc
ctcggcaaaaaggcagctggaatcgacgaacaggaaaactggcatgaaggcaaagaaaac
atcagagctgctgttgcagcggggtgcaggcagattcaagacctggagctctcgtctgtg
gaggtggatccctgtggagacgctcaggctgctgcggagggagcggtgcttggtctctat
gaatacgatgacctaaagcaaaaaaagaagatggctgtgtcggcaaagctctatggaagt
ggggatcaggaggcctggcagaaaggagtcctgtttgcttctgggcagaacttggcacgc
caattgatggagacgccagccaatgagatgacgccaaccagatttgctgaaattattgag
aagaatctcaaaagtgctagtagtaaaaccgaggtccatatcagacccaagtcttggatt
gaggaacaggcaatgggatcattcctcagtgtggccaaaggatctgacgagcccccagtc
ttcttggaaattcactacaaaggcagccccaatgcaaacgaaccacccctggtgtttgtt
gggaaaggaattacctttgacagtggtggtatctccatcaaggcttctgcaaatatggac
ctcatgagggctgacatgggaggagctgcaactatatgctcagccatcgtgtctgctgca
aagcttaatttgcccattaatattataggtctggcccctctttgtgaaaatatgcccagc
ggcaaggccaacaagccgggggatgttgttagagccaaaaacgggaagaccatccaggtt
gataacactgatgctgaggggaggctcatactggctgatgcgctctgttacgcacacacg
tttaacccgaaggtcatcctcaatgccgccaccttaacaggtgccatggatgtagctttg
ggatcaggtgccactggggtctttaccaattcatcctggctctggaacaaactcttcgag
gccagcattgaaacaggggaccgtgtctggaggatgcctctcttcgaacattatacaaga
caggttgtagattgccagcttgctgatgttaacaacattggaaaatacagatctgcagga
gcatgtacagctgcagcattcctgaaagaattcgtaactcatcctaagtgggcacattta
gacatagcaggcgtgatgaccaacaaagatgaagttccctatctacggaaaggcatgact
gggaggcccacaaggactctcattgagttcttacttcgtttcagtcaagacaatgcttag

DBGET integrated database retrieval system