KEGG   Homo sapiens (human): 51060Help
Entry
51060             CDS       T01001                                 

Gene name
TXNDC12, AG1, AGR1, ERP16, ERP18, ERP19, PDIA16, TLP19, hAG-1, hTLP19
Definition
thioredoxin domain containing 12 (endoplasmic reticulum) (EC:1.8.4.2)
Orthology
K05360  
protein-disulfide reductase (glutathione) [EC:1.8.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 172 aa AA seqDB search
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcggcctcgtctcggggccacctgtttgctgggcttcagtttcctgctcctc
gtcatctcttctgatggacataatgggcttggaaagggttttggagatcatattcattgg
aggacactggaagatgggaagaaagaagcagctgccagtggactgcccctgatggtgatt
attcataaatcctggtgtggagcttgcaaagctctaaagcccaaatttgcagaatctacg
gaaatttcagaactctcccataattttgttatggtaaatcttgaggatgaagaggaaccc
aaagatgaagatttcagccctgacgggggttatattccacgaatcctttttctggatccc
agtggcaaggtgcatcctgaaatcatcaatgagaatggaaaccccagctacaagtatttt
tatgtcagtgccgagcaagttgttcaggggatgaaggaagctcaggaaaggctgacgggt
gatgccttcagaaagaaacatcttgaagatgaattgtaa

DBGET integrated database retrieval system