KEGG   Homo sapiens (human): 51060Help
Entry
51060             CDS       T01001                                 

Gene name
TXNDC12, AG1, AGR1, ERP16, ERP18, ERP19, PDIA16, TLP19, hAG-1, hTLP19
Definition
(RefSeq) thioredoxin domain containing 12
  KO
K05360  protein-disulfide reductase (glutathione) [EC:1.8.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    51060 (TXNDC12)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.2  protein-disulfide reductase (glutathione)
     51060 (TXNDC12)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    51060 (TXNDC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_7 Thioredoxin Thioredoxin_2 Thioredox_DsbH Thioredoxin_9 Thioredoxin_8 AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 51060
NCBI-ProteinID: NP_056997
OMIM: 609448
HGNC: 24626
Ensembl: ENSG00000117862
Vega: OTTHUMG00000008629
Pharos: O95881(Tbio)
UniProt: O95881
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 172 aa AA seqDB search
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcggcctcgtctcggggccacctgtttgctgggcttcagtttcctgctcctc
gtcatctcttctgatggacataatgggcttggaaagggttttggagatcatattcattgg
aggacactggaagatgggaagaaagaagcagctgccagtggactgcccctgatggtgatt
attcataaatcctggtgtggagcttgcaaagctctaaagcccaaatttgcagaatctacg
gaaatttcagaactctcccataattttgttatggtaaatcttgaggatgaagaggaaccc
aaagatgaagatttcagccctgacgggggttatattccacgaatcctttttctggatccc
agtggcaaggtgcatcctgaaatcatcaatgagaatggaaaccccagctacaagtatttt
tatgtcagtgccgagcaagttgttcaggggatgaaggaagctcaggaaaggctgacgggt
gatgccttcagaaagaaacatcttgaagatgaattgtaa

DBGET integrated database retrieval system