KEGG   Homo sapiens (human): 51068Help
Entry
51068             CDS       T01001                                 

Gene name
NMD3, CGI-07
Definition
(RefSeq) NMD3 ribosome export adaptor
  KO
K07562  
nonsense-mediated mRNA decay protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    51068 (NMD3)
   03008 Ribosome biogenesis in eukaryotes
    51068 (NMD3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    51068 (NMD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q96D46(Tbio)
UniProt: 
Position
3q26.1
AA seq 503 aa AA seqDB search
MEYMAESTDRSPGHILCCECGVPISPNPANICVACLRSKVDISQGIPKQVSISFCKQCQR
YFQPPGTWIQCALESRELLALCLKKIKAPLSKVRLVDAGFVWTEPHSKRLKVKLTIQKEV
MNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWKAVIQVRQKTLHKKTFYYLEQLILKYG
MHQNTLRIKEIHDGLDFYYSSKQHAQKMVEFLQCTVPCRYKASQRLISQDIHSNTYNYKS
TFSVEIVPICKDNVVCLSPKLAQSLGNMNQICVCIRVTSAIHLIDPNTLQVADIDGSTFW
SHPFNSLCHPKQLEEFIVMECSIVQDIKRAAGAGMISKKHTLGEVWVQKTSEMNTDKQYF
CRTHLGHLLNPGDLVLGFDLANCNLNDEHVNKMNSDRVPDVVLIKKSYDRTKRQRRRNWK
LKELARERENMDTDDERQYQDFLEDLEEDEAIRKNVNIYRDSAIPVESDTDDEGAPRISL
AEMLEDLHISQDATGEEGASMLT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagtatatggcagaatccaccgaccgcagccctggacacatcttgtgctgtgagtgt
ggtgttccgataagtccaaatcctgccaatatttgtgtggcctgtttgcgaagtaaagtg
gacatcagccaaggtattccgaaacaagtctcgatttcgttctgcaaacaatgtcaaagg
tattttcaaccaccaggaacttggatacagtgtgctttagaatccagggaacttcttgct
ttgtgcttgaaaaaaatcaaagcccctctgagtaaggtacggcttgtagatgcaggcttt
gtttggactgagcctcattctaagagacttaaagttaaactgactattcagaaagaggtg
atgaatggtgctatccttcaacaagtgtttgtggtggattatgttgttcagtcccaaatg
tgtggagattgccatagagtagaagctaaggatttctggaaggctgtgattcaagtgagg
caaaagactttgcataaaaaaactttctactatctggaacagttaattctgaaatatgga
atgcatcagaatacacttcgtatcaaagagattcatgatggtctggatttttattattcc
tcaaaacaacatgctcagaagatggtcgaatttcttcagtgtacagttccctgtagatac
aaagcatcacaaagactgatctctcaagatatccatagtaacacatacaattacaaaagc
actttttctgtggaaattgttccaatatgcaaggataatgttgtctgtctgtctccaaaa
ctggcacaaagcctgggaaatatgaaccagatttgtgtgtgtattcgagtaaccagtgcc
attcacctcattgatccaaacaccctacaagtggcagatattgatgggagcactttctgg
agtcaccctttcaatagtttatgtcatcccaaacagctagaggagtttattgtgatggaa
tgcagcatagtccaagatataaaacgtgctgcaggtgctggaatgatatcaaaaaagcat
accctcggggaagtctgggtacagaagacatctgaaatgaatacagataaacagtatttt
tgtcgtactcatttgggacatcttctaaatcccggagacctggtgttagggtttgatttg
gccaactgtaacttaaatgatgagcatgtcaacaaaatgaactcagatagagttccagat
gtggtattaatcaagaagagctatgaccggaccaaacgtcagcgtcgtagaaactggaaa
ttgaaagagcttgcaagagagagagaaaacatggatacagatgatgaaaggcaataccaa
gattttcttgaagatcttgaagaagatgaggcaattcgaaaaaatgtcaacatttacaga
gattcagccatccctgtggaaagtgacaccgatgatgaaggagcacctcgaattagtctg
gctgagatgcttgaagaccttcatatttcccaagatgccactggtgaagaaggtgcatca
atgctgacataa

DBGET integrated database retrieval system