KEGG   Homo sapiens (human): 51072Help
Entry
51072             CDS       T01001                                 

Gene name
MEMO1, C2orf4, CGI-27, MEMO, NS5ATP7
Definition
(RefSeq) mediator of cell motility 1
  KO
K06990  
MEMO1 family protein
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     51072 (MEMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22-p21
AA seq 297 aa AA seqDB search
MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAA
HAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFE
RMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADP
SNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH
NTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccgagtggtctgccgagaagccagtcacgccgggagctggtacacagcctca
ggaccgcagctgaatgcacagctagaaggttggctttcacaagtacagtctacaaaaaga
cctgctagagccattattgccccccatgcaggatatacgtactgtgggtcttgtgctgcc
catgcttataaacaagtggatccgtctattacccggagaattttcatccttgggccttct
catcatgtgcccctctctcgatgtgcactttccagtgtggatatatataggacacctctg
tatgaccttcgtattgaccaaaagatttacggagaactgtggaagacaggaatgtttgaa
cgcatgtctctgcagacagatgaagatgaacacagtattgaaatgcatttgccttataca
gctaaagccatggaaagccataaggatgagtttaccattattcctgtactggttggagct
ctgagtgagtcaaaagaacaggaattcggaaaactcttcagtaaatatctagcggatcct
agtaatctctttgtggtttcttctgatttctgccattggggtcaaaggttccgttacagt
tactatgatgaatcccagggggagatttatagatccattgaacatctagataaaatgggt
atgagtattatagaacaattagaccctgtatcttttagcaattacttgaagaaataccat
aatactatatgtggaagacatcccattggggtgttattaaatgctatcacagagctccag
aagaatggaatgaatatgagtttttcgtttttgaattatgcccagtcgagccagtgtaga
aactggcaagacagttcagtgagttatgcagctggagcactcacggtccactga

DBGET integrated database retrieval system