KEGG   Homo sapiens (human): 51074Help
Entry
51074             CDS       T01001                                 

Gene name
APIP, APIP2, CGI29, MMRP19, hAPIP
Definition
APAF1 interacting protein (EC:4.2.1.109)
Orthology
K08964  
methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 242 aa AA seqDB search
MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAP
SGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKA
AVMATLLFPGREFKITHQEMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHA
MNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENG
IV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctgtgatgctcgggagggagactgttgttcccggagatgcggcgcgcaggac
aaggagcatccaagatacctgatcccagaactttgcaaacagttttaccatttaggctgg
gtcactgggactggaggaggaattagcttgaagcatggcgatgaaatctacattgctcct
tcaggagtgcaaaaggaacgaattcagcctgaagacatgtttgtttgtgatataaatgaa
aaggacataagtggaccttcgccatcgaagaagctaaaaaaaagccagtgtactcctctt
ttcatgaatgcttacacaatgagaggagcaggtgcagtgattcatacccactctaaagct
gctgtgatggccacacttctctttccaggacgggagtttaaaattacacatcaagagatg
ataaaaggaataaagaaatgtacttccggagggtattatagatatgatgatatgttagtg
gtacccattattgagaatacacctgaggagaaagacctcaaagatagaatggctcatgca
atgaatgaatacccagactcctgtgcagtactggtcagacgtcatggagtatatgtgtgg
ggggaaacatgggagaaggccaaaaccatgtgtgagtgttatgactatttatttgatatt
gccgtatcaatgaagaaagtaggacttgatccttcacagctcccagttggagaaaatgga
attgtctaa

DBGET integrated database retrieval system