KEGG   Homo sapiens (human): 51074Help
Entry
51074             CDS       T01001                                 

Gene name
APIP, APIP2, CGI-29, CGI29, MMRP19, hAPIP
Definition
(RefSeq) APAF1 interacting protein
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    51074 (APIP)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     51074 (APIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 51074
NCBI-ProteinID: NP_057041
OMIM: 612491
HGNC: 17581
Ensembl: ENSG00000149089
Vega: OTTHUMG00000166455
Pharos: Q96GX9(Tbio)
UniProt: Q96GX9
Structure
PDB: 

Jmol
Position
11p13
AA seq 242 aa AA seqDB search
MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAP
SGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKA
AVMATLLFPGREFKITHQEMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHA
MNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENG
IV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctgtgatgctcgggagggagactgttgttcccggagatgcggcgcgcaggac
aaggagcatccaagatacctgatcccagaactttgcaaacagttttaccatttaggctgg
gtcactgggactggaggaggaattagcttgaagcatggcgatgaaatctacattgctcct
tcaggagtgcaaaaggaacgaattcagcctgaagacatgtttgtttgtgatataaatgaa
aaggacataagtggaccttcgccatcgaagaagctaaaaaaaagccagtgtactcctctt
ttcatgaatgcttacacaatgagaggagcaggtgcagtgattcatacccactctaaagct
gctgtgatggccacacttctctttccaggacgggagtttaaaattacacatcaagagatg
ataaaaggaataaagaaatgtacttccggagggtattatagatatgatgatatgttagtg
gtacccattattgagaatacacctgaggagaaagacctcaaagatagaatggctcatgca
atgaatgaatacccagactcctgtgcagtactggtcagacgtcatggagtatatgtgtgg
ggggaaacatgggagaaggccaaaaccatgtgtgagtgttatgactatttatttgatatt
gccgtatcaatgaagaaagtaggacttgatccttcacagctcccagttggagaaaatgga
attgtctaa

DBGET integrated database retrieval system