KEGG   Homo sapiens (human): 51077Help
Entry
51077             CDS       T01001                                 

Gene name
FCF1, Bka, C14orf111, UTP24
Definition
FCF1 rRNA-processing protein
Orthology
K14566  
U3 small nucleolar RNA-associated protein 24
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 198 aa AA seqDB search
MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYN
TQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVA
LRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYIS
NHRYNIERMPDDYGAPRF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaaaagaaaacaaggaagtatgcgaccatgaagcgaatgcttagtctcaga
gatcagaggcttaaagaaaaggatagattaaaacctaaaaagaaagaaaagaaggatccc
agcgcattaaaggaaagagaagttccccaacacccttcctgcttatttttccaatataat
acacagctgggcccaccttaccacatcctcgttgataccaactttatcaacttttccata
aaagccaaactggacttagtgcagtcaatgatggactgtctgtatgccaagtgtatccca
tgtataaccgattgtgtaatggctgaaattgagaaattggggcagaagtatcgagtggct
ctaaggattgccaaggatccaagatttgaacgattaccatgtacacacaaaggaacctat
gcagatgactgcttagtacagagagtaactcagcataagtgttacattgtggccacagtt
gaccgggacctgaaaagaagaatccgtaagattcctggagttcctatcatgtacatttct
aaccatagatacaacattgaacggatgccagatgattatggagcccctcgattctaa

DBGET integrated database retrieval system