KEGG   Homo sapiens (human): 51082Help
Entry
51082             CDS       T01001                                 

Gene name
POLR1D, AC19, POLR1C, RPA16, RPA9, RPAC2, RPC16, RPO1-3, TCS2
Definition
polymerase (RNA) I polypeptide D, 16kDa
Orthology
K03020  
DNA-directed RNA polymerases I and III subunit RPAC2
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Cytosolic DNA-sensing pathway
Epstein-Barr virus infection
Module
RNA polymerase III, eukaryotes
RNA polymerase I, eukaryotes
Disease
H00610  
Treacher Collins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    51082 (POLR1D)
   00240 Pyrimidine metabolism
    51082 (POLR1D)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    51082 (POLR1D)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    51082 (POLR1D)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    51082 (POLR1D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     51082 (POLR1D)
  RNA polymerase I system
   RNA polymerase I
     51082 (POLR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.2
AA seq 94 aa AA seqDB search
MGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRS
HPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggacccatgggttggatgaagtgtcctcttgctagcaccaataaaagatttctaatt
aacacaattaaaaacacattgccctctcataaagagcaagaccatgaacaaaaagagggc
gataaggaaccagcgaagagccaggcccagaaagaagaaaacccgaagaaacacagaagc
catccttacaagcacagcttccgcgctcgaggttccgccagttactccccgccacgaaag
cggagcagccaggacaagtacgaaaagcggtccaaccggcggtga

DBGET integrated database retrieval system