KEGG   Homo sapiens (human): 51086Help
Entry
51086             CDS       T01001                                 

Gene name
TNNI3K, CARK, CCDD
Definition
(RefSeq) TNNI3 interacting kinase
  KO
K17535  serine/threonine-protein kinase TNNI3K [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51086 (TNNI3K)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   51086 (TNNI3K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ank_2 Ank_4 Ank Pkinase Ank_3 Ank_5 APH Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 51086
NCBI-ProteinID: NP_057062
OMIM: 613932
HGNC: 19661
Ensembl: ENSG00000116783
Vega: OTTHUMG00000171318
Pharos: Q59H18(Tchem)
UniProt: Q59H18
Structure
PDB: 

Jmol
Position
1p31.1
AA seq 835 aa AA seqDB search
MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNL
NYRTENGLSLLHLCCICGGKKSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDNAELITSL
LHSGADIQQVGYGGLTALHIATIAGHLEAADVLLQHGANVNIQDAVFFTPLHIAAYYGHE
QVTRLLLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNEDHVPLH
FCSRFGHHDIVKYLLQSDLEVQPHVVNIYGDTPLHLACYNGKFEVAKEIIQISGTESLTK
ENIFSETAFHSACTYGKSIDLVKFLLDQNVININHQGRDGHTGLHSACYHGHIRLVQFLL
DNGADMNLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPG
GDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKG
RCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQ
YISGGSLFSLLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDG
HAVVADFGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILT
GEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLE
ECLCNIELMSPASSNSSGSLSPSSSSDCLVNRGGPGRSHVAALRSRFELEYALNARSYAA
LSQSAGQYSSQGLSLEEMKRSLQYTPIDKYGYVSDPMSSMHFHSCRNSSSFEDSS
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattataaatctagaccaacccaaacttgtactgatgaatggaagaaaaaagtc
agtgaatcatatgttatcacaatagaaagattagaagatgacctgcagatcaaggaaaaa
gaactgacagaactaaggaatatatttggctctgatgaagccttcagtaaagtcaattta
aattaccgcactgaaaatgggctgtctctacttcatttatgttgcatttgtggaggcaag
aaatcacatattcgaactcttatgttgaaagggctccgcccatctcgactgacaagaaat
ggatttacagccttgcatttagcagtttacaaggataatgcagaattgatcacttctctg
cttcacagtggagctgatatacagcaggttggatacggtggcctcactgccctccatatt
gctacaatagctggccacctagaggctgctgatgtgctgttgcaacatggagctaatgtc
aatattcaagatgcagtttttttcactccattgcatattgcagcgtactatggacatgaa
caggtaactcgccttcttttgaaatttggtgctgatgtaaatgtaagtggtgaagttgga
gatagacccctccacctagcatctgcaaaaggattcttgaatattgcaaaactcttgatg
gaagaaggcagcaaagcagatgtgaatgctcaagataatgaagaccatgtcccactccat
ttctgttctcgatttggacaccatgatatagttaagtatctgctgcaaagtgatttggaa
gttcaacctcatgttgttaatatctatggagatacccccttacacctggcatgctacaat
ggcaaatttgaagttgccaaggaaatcatccaaatatcaggaacagaaagtctgactaag
gaaaacatcttcagtgaaacagcttttcatagtgcttgtacctatggcaagagcattgac
ctagtcaaatttcttcttgatcagaatgtcataaacatcaaccaccaaggaagggatggg
cacactggattacactctgcttgctaccacggtcacattcgcctggttcagttcttactg
gataatggagctgatatgaatctagtggcttgtgatcccagcaggtctagtggtgaaaaa
gatgagcagacatgtttgatgtgggcttatgaaaaagggcatgatgccattgtcacactc
ctgaagcattataagagaccacaagatgaattgccctgtaatgaatattctcagcctgga
ggagatggctcctatgtgtctgttccatcacccttggggaagattaaaagcatgacaaaa
gagaaggcagatattctcctcctaagagctggattgccttcacatttccatcttcagctc
tcagaaattgagttccatgagattattggctcaggttcttttgggaaagtatataaagga
cgatgcagaaataaaatagtggctataaaacgttatcgagccaatacctactgctccaag
tcagatgtggatatgttttgccgagaggtgtccattctctgccagctcaatcatccctgc
gtaattcagtttgtgggtgcttgcttgaatgatcccagccagtttgccattgtcactcaa
tacatatcagggggttctctgttctccctccttcatgagcagaagaggattcttgatttg
cagtctaaattaattattgcagtagatgttgccaaaggcatggagtaccttcacaacctg
acacagccaattatacatcgtgacttgaacagtcacaatattcttctctatgaggatggg
catgctgtggtggcagattttggagaatcaagatttctacagtctctggatgaagacaac
atgacaaaacaacctgggaacctccgttggatggctcctgaggtgttcacgcagtgcact
cggtacaccatcaaagcagatgtcttcagctatgctctgtgtctgtgggaaattctcact
ggcgaaattccattcgctcatctcaagccagcggctgcggcagcagacatggcttaccac
cacatcagacctcccattggctattccattcccaagcccatatcatctctgctgatacga
gggtggaacgcatgtcctgaaggaagacccgaattttctgaagttgtcatgaagttagaa
gagtgtctctgcaacattgagctgatgtctcctgcatcaagtaacagcagtgggtctctc
tcaccttcttcttcttctgattgcctggtgaaccggggaggacctggccggagtcatgtg
gcagcattaagaagtcgtttcgaattggaatatgctctaaatgcaaggtcctatgctgct
ttgtcccaaagtgctggacaatattcctctcaaggtctgtctttggaggagatgaaaaga
agtcttcaatacacacccattgacaaatatggctatgtatccgatcccatgagctcaatg
cattttcattcttgccgaaatagtagcagctttgaggacagcagctga

DBGET integrated database retrieval system