KEGG   Homo sapiens (human): 51094Help
Entry
51094             CDS       T01001                                 

Gene name
ADIPOR1, ACDCR1, CGI45, PAQR1, TESBP1A
Definition
adiponectin receptor 1
Orthology
K07297  
adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    51094 (ADIPOR1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    51094 (ADIPOR1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51094 (ADIPOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 375 aa AA seqDB search
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgtggtggcacaggggaatggggctcctgccagtaacagg
gaagctgacacggtggaactggctgaactgggacccctgctagaagagaagggcaaacgg
gtaatcgccaacccacccaaagctgaagaagagcaaacatgcccagtgccccaggaagaa
gaggaggaggtgcgggtactgacacttcccctgcaagcccaccacgccatggagaagatg
gaagagtttgtgtacaaggtctgggagggacgttggagggtcatcccatatgatgtgctc
cctgactggctaaaggacaacgactatctgctacatggtcatagacctcccatgccctcc
tttcgggcttgcttcaagagcatcttccgcattcatacagaaactggcaacatctggacc
catctgcttggtttcgtgctgtttctctttttgggaatcttgaccatgctcagaccaaat
atgtacttcatggcccctctacaggagaaggtggtttttgggatgttctttttgggtgca
gtgctctgcctcagcttctcctggctctttcacaccgtctattgtcattcagagaaagtc
tctcggactttttccaaactggactattcagggattgctcttctaattatggggagcttt
gtcccctggctctattattccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatttctgccatcattgtggcgcagtgggaccggtttgccact
cctaagcaccggcagacaagagcaggcgtgttcctgggacttggcttgagtggcgtcgtg
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcactggagctggcctttatgctgctcga
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcagcctttgtccacttctatggagtctccaaccttcaggaa
ttccgttacggcctagaaggcggctgtactgatgacacccttctctga

DBGET integrated database retrieval system