KEGG   Homo sapiens (human): 51094Help
Entry
51094             CDS       T01001                                 

Gene name
ADIPOR1, ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A
Definition
(RefSeq) adiponectin receptor 1
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    51094 (ADIPOR1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    51094 (ADIPOR1)
  Aging
   04211 Longevity regulating pathway - mammal
    51094 (ADIPOR1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51094 (ADIPOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII DUF4405 DUF962
Motif
Other DBs
NCBI-GeneID: 51094
NCBI-ProteinID: NP_001277482
OMIM: 607945
HGNC: 24040
Ensembl: ENSG00000159346
Vega: OTTHUMG00000041391
Pharos: Q96A54(Tbio)
UniProt: Q96A54
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 375 aa AA seqDB search
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgtggtggcacaggggaatggggctcctgccagtaacagg
gaagctgacacggtggaactggctgaactgggacccctgctagaagagaagggcaaacgg
gtaatcgccaacccacccaaagctgaagaagagcaaacatgcccagtgccccaggaagaa
gaggaggaggtgcgggtactgacacttcccctgcaagcccaccacgccatggagaagatg
gaagagtttgtgtacaaggtctgggagggacgttggagggtcatcccatatgatgtgctc
cctgactggctaaaggacaacgactatctgctacatggtcatagacctcccatgccctcc
tttcgggcttgcttcaagagcatcttccgcattcatacagaaactggcaacatctggacc
catctgcttggtttcgtgctgtttctctttttgggaatcttgaccatgctcagaccaaat
atgtacttcatggcccctctacaggagaaggtggtttttgggatgttctttttgggtgca
gtgctctgcctcagcttctcctggctctttcacaccgtctattgtcattcagagaaagtc
tctcggactttttccaaactggactattcagggattgctcttctaattatggggagcttt
gtcccctggctctattattccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatttctgccatcattgtggcgcagtgggaccggtttgccact
cctaagcaccggcagacaagagcaggcgtgttcctgggacttggcttgagtggcgtcgtg
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcactggagctggcctttatgctgctcga
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcagcctttgtccacttctatggagtctccaaccttcaggaa
ttccgttacggcctagaaggcggctgtactgatgacacccttctctga

KEGG   Homo sapiens (human): 79602Help
Entry
79602             CDS       T01001                                 

Gene name
ADIPOR2, ACDCR2, PAQR2
Definition
(RefSeq) adiponectin receptor 2
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    79602 (ADIPOR2)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    79602 (ADIPOR2)
  Aging
   04211 Longevity regulating pathway - mammal
    79602 (ADIPOR2)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    79602 (ADIPOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII PRR18
Motif
Other DBs
NCBI-GeneID: 79602
NCBI-ProteinID: NP_078827
OMIM: 607946
HGNC: 24041
Ensembl: ENSG00000006831
Vega: OTTHUMG00000130139
Pharos: Q86V24(Tbio)
UniProt: Q86V24
Structure
PDB: 

Jmol
Position
12p13.33
AA seq 386 aa AA seqDB search
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCSEEDAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccaacagaaaaccgattggggtgcagcaggactccagagccagatataagg
ctcagaaaagggcaccaactggatggtacacgaagaggtgataatgacagccaccaagga
gatttggagcccattttagaggcatctgttctatcttcccatcataaaaaaagctctgag
gaacatgaatacagtgatgaagctcctcaggaagatgagggctttatgggcatgtcccct
ctcttacaagcccatcatgctatggaaaaaatggaagaatttgtttgtaaggtatgggaa
ggtcggtggcgagtgatccctcatgatgtactaccagactggctcaaggataatgacttc
ctcttgcatggacaccggcctcctatgccttctttccgggcctgttttaagagcattttc
agaatacacacagaaacaggcaacatttggacacatctcttaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatctcctttgtggcccctctgcaagag
aaggtggtctttggattatttttcttaggagccattctctgcctttctttttcatggctc
ttccacacagtctactgccactcagagggggtctctcggctcttctctaaactggattac
tctggtattgctcttctgattatgggaagttttgttccttggctttattattctttctac
tgtaatccacaaccttgcttcatctacttgattgtcatctgtgtgctgggcattgcagcc
attatagtctcccagtgggacatgtttgccacccctcagtatcggggagtaagagcagga
gtgtttttgggcctaggcctgagtggaatcattcctaccttgcactatgtcatctcggag
gggttccttaaggccgccaccatagggcagataggctggttgatgctgatggccagcctc
tacatcacaggagctgccctgtatgctgcccggatccccgaacgctttttccctggcaaa
tgtgacatctggtttcactctcatcagctgtttcatatctttgtggttgctggagctttt
gttcacttccatggtgtctcaaacctccaggagtttcgtttcatgatcggcgggggctgc
agtgaagaggatgcactgtga

DBGET integrated database retrieval system