KEGG   Homo sapiens (human): 51095Help
Entry
51095             CDS       T01001                                 

Gene name
TRNT1, CCA1, MtCCA
Definition
tRNA nucleotidyl transferase, CCA-adding, 1 (EC:2.7.7.72)
Orthology
K00974  
tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    51095 (TRNT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     51095 (TRNT1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     51095 (TRNT1)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     51095 (TRNT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   CCA adding factor
    51095 (TRNT1)
 Prokaryotic Type
    51095 (TRNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p25.1
AA seq 434 aa AA seqDB search
MLRCLYHWHRPVLNRRWSRLCLLKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELR
IAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENF
EITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKK
VRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWV
ELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLF
KVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATT
RVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY
QMEKDELLSYIKKT
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggtgcctgtatcattggcacaggccagtgctgaaccgtaggtggagtaggctg
tgccttctgaagcagtatctattcacaatgaagttgcagtctcccgaattccagtcactt
ttcacagaaggactgaagagtctgacagaattatttgtcaaagagaatcacgaattaaga
atagcaggaggagcagtgagggatttattaaatggagtaaagcctcaggatatagatttt
gccaccactgctacccctactcaaatgaaggagatgtttcagtcggctgggattcggatg
ataaacaacagaggagaaaagcacggaacaattactgccaggcttcatgaagaaaatttt
gagattactacactacggattgatgtcaccactgatggaagacatgctgaggtagaattt
acaactgactggcagaaagatgcggaacgcagagatctcactataaattctatgttttta
ggttttgatggcactttatttgactactttaatggttatgaagatttaaaaaataagaaa
gttagatttgttggacatgctaaacagagaatacaagaggattatcttagaattttaaga
tacttcaggttttatgggagaattgtagacaaacctggtgaccatgatcctgagactttg
gaagcaattgcagaaaatgcaaaaggcttggctggaatatcaggagaaaggatttgggtg
gaactgaaaaaaattcttgttggtaaccatgtaaatcatttgattcaccttatctatgat
cttgatgtggctccttatataggtttacctgctaatgcaagtttagaagaatttgacaaa
gtcagtaaaaatgttgatggtttttcaccaaagccagtgactcttttggcctcattattc
aaagtacaagatgatgtcacaaaattggatttgaggttgaagatcgcaaaagaggagaaa
aaccttggcttatttatagttaaaaataggaaagatttaattaaagcaacagatagttca
gacccattgaaaccctatcaagacttcattatagattctagggaacctgatgcaactact
cgtgtatgtgaactactgaagtaccaaggagagcactgtctcctaaaggaaatgcagcag
tggtccattcctccatttcctgtaagtggccatgacatcagaaaagtgggcatttcttca
ggaaaagaaattggggctctattacaacagttgcgagaacagtggaaaaaaagtggttac
caaatggaaaaagatgaacttctgagttacataaagaagacctaa

DBGET integrated database retrieval system