KEGG   Homo sapiens (human): 51096Help
Entry
51096             CDS       T01001                                 

Gene name
UTP18, CGI-48, WDR50
Definition
UTP18 small subunit (SSU) processome component homolog (yeast)
Orthology
K14553  
U3 small nucleolar RNA-associated protein 18
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.33
AA seq 556 aa AA seqDB search
MPPERRRRMKLDRRTGAKPKRKPGMRPDWKAGAGPGGPPQKPAPSSQRKPPARPSAAAAA
IAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVENDEDALLRRLRGPRVQEHED
SGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKK
RLKEEFQHAMGGVPAWAETTKRKTSSDDESEEDEDDLLQRTGNFISTSTSLPRGILKMKN
CQHANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQVDGKTNPKIQSIYLERFPIFK
ACFSANGEEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVSPDGSFLLING
IAGYLHLLAMKTKELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRF
VDEGSLYGLSIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLT
FNPTTEILAIASEKMKEAVRLVHLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGN
EKGKALMYRLHHYSDF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggagcggaggagacgaatgaaactggaccggagaaccggagcgaagccgaag
cggaagcccggaatgaggccggactggaaagccggagcggggccaggcgggcctccccaa
aagcctgccccttcatcccagcggaaaccgccggcccggccgagcgcggcggccgctgcg
attgcagtcgcggcggcggaggaagagagacggctccggcagcggaaccgcctgaggctg
gaggaggacaaaccggccgtggagcggtgcttggaggagctggtcttcggcgacgtcgag
aacgacgaggacgcgttgctgcggcgtctgcgaggcccgagggttcaagaacatgaagac
tcgggtgactcagaagtggagaatgaagcaaaaggtaattttccacctcaaaagaagcca
gtttgggtggatgaagaagatgaagatgaggaaatggttgacatgatgaacaatcggttt
cggaaggatatgatgaaaaatgctagtgaaagtaaactttcgaaagacaaccttaaaaag
agacttaaagaagaattccaacatgccatgggaggagtacctgcctgggcagagactact
aagcggaaaacatcttcagatgatgaaagtgaagaggatgaagatgatttgttgcaaagg
actgggaatttcatatccacatcaacttctcttccaagaggaatcttgaagatgaagaac
tgccagcatgcgaatgctgaacgtcctactgttgctcggatctcatctgtgcagttccat
cccggtgcacagattgtgatggttgctggattagataatgctgtatcactatttcaggtt
gatgggaaaacaaatcctaaaattcagagcatctatttggaaaggtttccaatctttaag
gcttgttttagtgctaatggggaagaagttttagccacgagtacccacagcaaggttctt
tatgtctatgacatgctggctggaaagttaattcctgtgcatcaagtgagaggtttgaaa
gagaagatagtgaggagctttgaagtctccccagatgggtccttcttgctcataaatggc
attgctggatatttgcatttgctagcaatgaagaccaaagaactgattggaagcatgaaa
attaatggaagggttgcagcatccacattctcttcagatagtaagaaagtatacgcctct
tcgggggatggagaagtttatgtttgggatgtgaactcaaggaagtgccttaacagattt
gttgatgaaggcagtttatatggattaagcattgccacatctaggaatggacagtatgtt
gcttgtggttctaattgtggagtggtaaatatatacaatcaagattcttgtctccaagaa
acaaacccaaagccaataaaagctataatgaacttggttacaggtgttacttctctgacc
ttcaatcctactacagaaatcttggcaattgcttcagaaaaaatgaaagaagcagtcaga
ttggttcatcttccttcctgtacagtattttcaaacttcccagtcattaaaaataagaat
atttctcatgttcataccatggatttttctccgagaagtggatactttgccttggggaat
gaaaagggcaaggccctgatgtataggttgcaccattactcagacttctaa

DBGET integrated database retrieval system