KEGG   Homo sapiens (human): 5110Help
Entry
5110              CDS       T01001                                 

Gene name
PCMT1, PIMT
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     5110 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q24-q25
AA seq 286 aa AA seqDB search
MPGARSGGSGGDGSNSGSYSGDASGAVTVWEVVSLLGKLLGTVVALKVVLYLLRVCLAMA
WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAP
HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNN
VRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP
VGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggcagcggcggcgacggcagtaacagcggcagctacagc
ggggacgcgagcggggcggtgacggtgtgggaggtggtctcactcttgggaaaactgctg
ggcaccgtcgtcgcgctgaaggtggttctgtacctgctccgagtgtgcttagcgatggcc
tggaaatccggcggcgccagccactcggagctaatccacaatctccgcaaaaatggaatc
atcaagacagataaagtatttgaagtgatgctggctacagaccgctcccactatgcaaaa
tgtaacccatacatggattctccacaatcaataggtttccaagcaacaatcagtgctcca
cacatgcatgcatatgcgctagaacttctatttgatcagttgcatgaaggagctaaagct
cttgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggttggatgt
actggaaaagtcataggaattgatcacattaaagagctagtagatgactcagtaaataat
gtcaggaaggacgatccaacacttctgtcttcagggagagtacagcttgttgtgggggat
ggaagaatgggatatgctgaagaagccccttatgatgccattcatgtgggagctgcagcc
cctgttgtaccccaggcgctaatagatcagttaaagcccggaggaagattgatattgcct
gttggtcctgcaggcggaaaccaaatgttggagcagtatgacaagctacaagatggcagc
atcaaaatgaagcctctgatgggggtgatatacgtgcctttaacagataaagaaaagcag
tggtccagggatgaattgtaa

DBGET integrated database retrieval system