KEGG   Homo sapiens (human): 51100Help
Entry
51100             CDS       T01001                                 

Gene name
SH3GLB1, Bif-1, PPP1R70, dJ612B15.2
Definition
SH3-domain GRB2-like endophilin B1
Orthology
K11248  
endophilin-B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    51100 (SH3GLB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     51100 (SH3GLB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    51100 (SH3GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22
AA seq 394 aa AA seqDB search
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSQLNSARLEGDNIMVNFSYMLNFLHVKWLKSEQELRITQSEFDRQAEITRL
LLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPV
PSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEV
ITVFSVVGMDSDWLMGERGNQKGKVPITYLELLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatggacttcaacgtgaagaagctggcggccgacgcaggcaccttcctcagt
cgcgccgtgcagttcacagaagaaaagcttggccaggctgagaagacagaattggatgct
cacttagagaacctccttagcaaagctgaatgtaccaaaatatggacagaaaaaataatg
aaacaaactgaagtgttattgcagccaaatccaaatgccaggatagaagaatttgtttat
gagaaactggatagaaaagctccaagtcgtataaacaacccagaacttttgggacaatat
atgattgatgcagggactgagtttggcccaggaacagcttatggtaatgcccttattaaa
tgtggagaaacccaaaaaagaattggaacagcagacagagaactgattcaaacgtcagcc
ttaaattttcttactcctttaagaaactttatagaaggagattacaaaacaattgctaaa
gaaaggaaactattgcaaaataagagactggatttggatgctgcaaaaacgagactaaaa
aaggcaaaagctgcagaaactagaaattcacaactaaactcagctcgccttgaaggagat
aacattatggtaaatttctcttacatgctcaacttcctgcatgtaaaatggctgaagtct
gaacaggaattaagaataactcaaagtgaatttgatcgtcaagcagagattaccagactt
ctgctagagggaatcagcagtacacatgcccatcaccttcgctgtctgaatgactttgta
gaagcccagatgacttactatgcacagtgttaccagtatatgttggacctccagaaacaa
ctgggaagttttccatccaattatcttagtaacaacaatcagacttctgtgacacctgta
ccatcagttttaccaaatgcgattggttcttctgccatggcttcaacaagtggcctagta
atcacctctccttccaacctcagtgaccttaaggagtgtagtggcagcagaaaggccagg
gttctctatgattatgatgcagcaaacagtactgaattatcacttctggcagatgaggtg
atcactgtgttcagtgttgttggaatggattcagactggctaatgggggaaaggggaaac
cagaagggcaaggtgccaattacctacttagaactgctcaattaa

DBGET integrated database retrieval system