KEGG   Homo sapiens (human): 51102Help
Entry
51102             CDS       T01001                                 

Gene name
MECR, CGI-63, FASN2B, NRBF1
Definition
mitochondrial trans-2-enoyl-CoA reductase (EC:1.3.1.38)
Orthology
K07512  
mitochondrial trans-2-enoyl-CoA reductase [EC:1.3.1.38]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35.3
AA seq 297 aa AA seqDB search
MLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLG
TWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGV
GQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQ
PRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWK
KDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcccctatcaatccatctgacataaatatgatccaaggaaactacggactc
cttcctgaactgcctgctgttggagggaacgaaggtgttgcacaggtggtagcggtgggc
agcaatgtgaccgggctgaagccaggagactgggtgattccagcaaatgctggtttagga
acctggcggaccgaggctgtgttcagcgaggaagcactgatccaagttccgagtgacatc
cctcttcagagcgctgccaccctgggtgtcaatccctgcacagcctacaggatgttgatg
gacttcgagcaactgcagccaggggattctgtcatccagaatgcatccaacagcggagtg
gggcaagcggtcatccagatcgccgcagccctgggcctaagaaccatcaatgtggtccga
gacagacctgatatccagaagctgagtgacagactgaagagtctgggggctgagcatgtc
atcacagaagaggagctaagaaggcccgaaatgaaaaacttctttaaggacatgccccag
ccacggcttgctctcaactgtgttggtgggaaaagctccacagagctgctgcggcagtta
gcgcgtggaggaaccatggtaacctatggggggatggccaagcagcccgtcgtagcctct
gtgagcctgctcatttttaaggatctcaaacttcgaggcttttggttgtcccagtggaag
aaggatcacagtccagaccagttcaaggagctgatcctcacactgtgcgatctcatccgc
cgaggccagctcacagcccctgcctgctcccaggtcccgctgcaggactaccagtctgcc
ttggaagcctccatgaagcccttcatatcttcaaagcagattctcaccatgtga

DBGET integrated database retrieval system