KEGG   Homo sapiens (human): 51107Help
Entry
51107             CDS       T01001                                 

Gene name
APH1A, 6530402N02Rik, APH-1, APH-1A, CGI-78
Definition
APH1A gamma secretase subunit
Orthology
K06172  
anterior pharynx defective 1
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    51107 (APH1A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    51107 (APH1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.13-q31.3
AA seq 265 aa AA seqDB search
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCRRQEDSRVMVYSALRIPPED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggggctgcggtgtttttcggctgcactttcgtcgcgttcggcccggccttcgcgctt
ttcttgatcactgtggctggggacccgcttcgcgttatcatcctggtcgcaggggcattt
ttctggctggtctccctgctcctggcctctgtggtctggttcatcttggtccatgtgacc
gaccggtcagatgcccggctccagtacggcctcctgatttttggtgctgctgtctctgtc
cttctacaggaggtgttccgctttgcctactacaagctgcttaagaaggcagatgagggg
ttagcatcgctgagtgaggacggaagatcacccatctccatccgccagatggcctatgtt
tctggtctctccttcggtatcatcagtggtgtcttctctgttatcaatattttggctgat
gcacttgggccaggtgtggttgggatccatggagactcaccctattacttcctgacttca
gcctttctgacagcagccattatcctgctccataccttttggggagttgtgttctttgat
gcctgtgagaggagacggtactgggctttgggcctggtggttgggagtcacctactgaca
tcgggactgacattcctgaacccctggtatgaggccagcctgctgcccatctatgcagtc
actgtttccatggggctctgggccttcatcacagctggagggtccctccgaagtattcag
cgcagcctcttgtgccgacggcaggaggacagtcgggtgatggtgtattctgccctgcgc
atcccacccgaggactga

DBGET integrated database retrieval system