KEGG   Homo sapiens (human): 51127Help
Entry
51127             CDS       T01001                                 

Gene name
TRIM17, RBCC, RNF16, terf
Definition
(RefSeq) tripartite motif containing 17
  KO
K12007  
tripartite motif-containing protein 17 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51127 (TRIM17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    51127 (TRIM17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y577(Tbio)
UniProt: 
Position
1q42.13
AA seq 477 aa AA seqDB search
MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECREMSPQRNLLPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLVEEEQRLLQALETEEEETASRLRESVACLDRQGHSLELLLLQLE
ERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
ATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGMNIT
GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGI
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtggaactcgccagaaaactgcaggaggaagctacgtgctccatctgtctg
gattacttcacagaccctgtgatgaccacctgtggccacaacttctgccgagcctgcatc
cagctgagctgggaaaaggcgaggggcaagaaggggaggcggaagcggaagggctccttc
ccctgccccgagtgcagagagatgtccccgcagaggaacctgctgcccaaccggctgctg
accaaggtggccgagatggcgcagcagcatcctggtctgcagaagcaagacctgtgccag
gagcaccacgagcccctcaagcttttctgccagaaggaccagagccccatctgtgtggtg
tgcagggagtcccgggagcaccggctgcacagggtgctgcccgccgaggaggcagtgcag
gggtacaagttgaagctggaggaggacatggagtaccttcgggagcagatcaccaggaca
gggaatctgcaggccagggaggagcagagcttagccgagtggcagggcaaggtgaaggag
cggagagaacgcattgtgctggagtttgagaagatgaacctctacctggtggaagaagag
cagaggctcctccaggctctggagacggaagaagaggagactgccagcaggctccgggag
agcgtggcctgcctggaccggcagggtcactctctggagctgctgctgctgcagctggag
gagcggagcacacaggggcccctccagatgctgcaggacatgaaggaacccctgagcagg
aagaacaacgtgagtgtgcagtgcccagaggttgcccccccaaccagacccaggactgtg
tgcagagttcccggacagattgaagtgctaagaggctttctagaggatgtggtgcctgat
gccacctccgcgtacccctacctcctcctgtatgagagccgccagaggcgctacctcggc
tcttcgccggagggcagtgggttctgcagcaaggaccgatttgtggcttacccctgtgct
gtgggccagacggccttctcctctgggaggcactactgggaggtgggcatgaacatcacc
ggggacgcgttgtgggccctgggtgtgtgcagggacaacgtgagccggaaagacagggtc
cccaagtgccccgaaaacggcttctgggtggtgcagctgtccaaggggaccaagtactta
tccaccttctctgccctaaccccggtcatgctgatggagcctcccagccacatgggcatc
ttcctggacttcgaagccggggaagtgtccttctacagtgtaagcgatgggtcccacctg
cacacctactcccaggccaccttcccaggccccctgcagcctttcttctgcctgggggct
ccgaagtctggtcagatggtcatctccacagtgaccatgtgggtgaaaggatag

DBGET integrated database retrieval system