KEGG   Homo sapiens (human): 51164Help
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  
dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    51164 (DCTN4)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    51164 (DCTN4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Dynactin complex
     51164 (DCTN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     51164 (DCTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.1
AA seq 460 aa AA seqDB search
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVV
PPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcggac
aaatatggtcttggaaccaggcttcagcgaccacgagctggtgcatccatcagtaccctt
gccggactttcccttaaagaaggagaggatcagaaagagataaagattgagccagctcag
gctgtggatgaagtggaacctctacctgaagactattatacaagaccagtaaatttaaca
gaggtaacaacccttcagcagcgtctgttacagcctgacttccagccagtctgtgcttca
cagctctatcctcgccacaaacatcttctgatcaaacggtccctgcgctgccgtaaatgt
gaacataatttgagcaagccagaatttaacccaacgtcaatcaaattcaaaatccagctg
gtcgctgtcaattatattccagaagtgagaatcatgtcaattcccaaccttcgctacatg
aaggagagccaggtcctcctgactcttacaaatccagttgagaacctcacccatgtgact
ctcttcgagtgtgaggagggggaccctgatgatatcaacagcactgctaaggtggtggtg
cctcccaaagagctcgttttagctggcaaggatgcagcagcagagtacgatgagttggca
gaacctcaagactttcaggacgatcctgacattatagccttcagaaaggccaacaaagtg
ggtattttcatcaaagttacaccacagcgtgaggagggtgaagtgaccgtgtgcttcaag
atgaagcatgattttaaaaacctggcagcccccattcgccccattgaagaaagtgaccag
ggaacagaagtcatctggctcacccagcatgtggaacttagcttgggcccacttcttcct
taa

DBGET integrated database retrieval system