KEGG   Homo sapiens (human): 51164Help
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
(RefSeq) dynactin 4 (p62)
  KO
K10426  
dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    51164 (DCTN4)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    51164 (DCTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31-q32
AA seq 467 aa AA seqDB search
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDIN
STAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEG
EVTVCFKMKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcgcaa
catactattcatgtagtggacaaatatggtcttggaaccaggcttcagcgaccacgagct
ggtgcatccatcagtacccttgccggactttcccttaaagaaggagaggatcagaaagag
ataaagattgagccagctcaggctgtggatgaagtggaacctctacctgaagactattat
acaagaccagtaaatttaacagaggtaacaacccttcagcagcgtctgttacagcctgac
ttccagccagtctgtgcttcacagctctatcctcgccacaaacatcttctgatcaaacgg
tccctgcgctgccgtaaatgtgaacataatttgagcaagccagaatttaacccaacgtca
atcaaattcaaaatccagctggtcgctgtcaattatattccagaagtgagaatcatgtca
attcccaaccttcgctacatgaaggagagccaggtcctcctgactcttacaaatccagtt
gagaacctcacccatgtgactctcttcgagtgtgaggagggggaccctgatgatatcaac
agcactgctaaggtggtggtgcctcccaaagagctcgttttagctggcaaggatgcagca
gcagagtacgatgagttggcagaacctcaagactttcaggacgatcctgacattatagcc
ttcagaaaggccaacaaagtgggtattttcatcaaagttacaccacagcgtgaggagggt
gaagtgaccgtgtgcttcaagatgaagcatgattttaaaaacctggcagcccccattcgc
cccattgaagaaagtgaccagggaacagaagtcatctggctcacccagcatgtggaactt
agcttgggcccacttcttccttaa

DBGET integrated database retrieval system