KEGG   Homo sapiens (human): 51164Help
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
dynactin 4 (p62)
Orthology
K10426  
dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Huntington's disease
Class
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31-q32
AA seq 467 aa AA seqDB search
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDIN
STAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEG
EVTVCFKMKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcgcaa
catactattcatgtagtggacaaatatggtcttggaaccaggcttcagcgaccacgagct
ggtgcatccatcagtacccttgccggactttcccttaaagaaggagaggatcagaaagag
ataaagattgagccagctcaggctgtggatgaagtggaacctctacctgaagactattat
acaagaccagtaaatttaacagaggtaacaacccttcagcagcgtctgttacagcctgac
ttccagccagtctgtgcttcacagctctatcctcgccacaaacatcttctgatcaaacgg
tccctgcgctgccgtaaatgtgaacataatttgagcaagccagaatttaacccaacgtca
atcaaattcaaaatccagctggtcgctgtcaattatattccagaagtgagaatcatgtca
attcccaaccttcgctacatgaaggagagccaggtcctcctgactcttacaaatccagtt
gagaacctcacccatgtgactctcttcgagtgtgaggagggggaccctgatgatatcaac
agcactgctaaggtggtggtgcctcccaaagagctcgttttagctggcaaggatgcagca
gcagagtacgatgagttggcagaacctcaagactttcaggacgatcctgacattatagcc
ttcagaaaggccaacaaagtgggtattttcatcaaagttacaccacagcgtgaggagggt
gaagtgaccgtgtgcttcaagatgaagcatgattttaaaaacctggcagcccccattcgc
cccattgaagaaagtgaccagggaacagaagtcatctggctcacccagcatgtggaactt
agcttgggcccacttcttccttaa

DBGET integrated database retrieval system