KEGG   Homo sapiens (human): 51172Help
Entry
51172             CDS       T01001                                 

Gene name
NAGPA, APAA, UCE
Definition
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (EC:3.1.4.45)
Orthology
K01125  
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [EC:3.1.4.45]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 515 aa AA seqDB search
MATSTGRWLLLRLALFGFLWEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGNRE
HESWPPPPATPGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRR
ATVEETARAADCRVAQNGGFFRMNSGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVT
GYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISAR
TAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLA
SYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDEL
DCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKCEHHCPCDPKTGN
CSVSRVKQCLQPPEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNR
RLHGDYAYHPLQEMNGEPLAAEKEQPGGAHNPFKD
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctccacgggtcgctggcttctcctccggcttgcactattcggcttcctctgg
gaagcgtccggcggcctcgactcgggggcctcccgcgacgacgacttgctactgccctat
ccacgcgcgcgcgcgcgcctcccccgggactgcacacgggtgcgcgccggcaaccgcgag
cacgagagttggcctccgcctcccgcgactcccggcgccggcggtctggccgtgcgcacc
ttcgtgtcgcacttcagggaccgcgcggtggccggccacctgacgcgggccgttgagccc
ctgcgcaccttctcggtgctggagcccggtggacccggcggctgcgcggcgagacgacgc
gccaccgtggaggagacggcgcgggcggccgactgccgtgtcgcccagaacggcggcttc
ttccgcatgaactcgggcgagtgcctggggaacgtggtgagcgacgagcggcgggtgagc
agctccggggggctgcagaacgcgcagttcgggatccgccgcgacgggaccctggtcacc
gggtacctgtctgaggaggaggtgctggacactgagaacccatttgtgcagctgctgagt
ggggtcgtgtggctgattcgtaatggaagcatctacatcaacgagagccaagccacagag
tgtgacgagacacaggagacaggttcctttagcaaatttgtgaatgtgatatcagccagg
acggccattggccacgaccggaaagggcagctggtgctctttcatgcagacggccaaacg
gagcagcgtggcatcaacctgtgggaaatggcggagttcctgctgaaacaggacgtggtc
aacgccatcaacctggatgggggtggctctgccacctttgtgctcaacgggaccttggcc
agttacccgtcagatcactgccaggacaacatgtggcgctgtccccgccaagtgtccacc
gtggtgtgtgtgcacgaaccccgctgccagccgcctgactgccacggccacgggacctgc
gtggacgggcactgccaatgcaccgggcacttctggcggggtcccggctgtgatgagctg
gactgtggcccctctaactgcagccagcacggactgtgcacggagaccggctgccgctgt
gatgccggatggaccgggtccaactgcagtgaagagtgtccccttggctggcatgggccg
ggctgccagaggccttgtaagtgtgagcaccattgtccctgtgaccccaagactggcaac
tgcagcgtctccagagtaaagcagtgtctccagccacctgaagccaccctgagggcggga
gaactctcctttttcaccaggaccgcctggctagccctcaccctggcgctggccttcctc
ctgctgatcagcactgcagcaaacctgtccttgctcctgtccagagcagagaggaaccgg
cgcctgcatggggactatgcataccacccgctgcaggagatgaacggggagcctctggcc
gcagagaaggagcagccagggggcgcccacaaccccttcaaggactga

DBGET integrated database retrieval system