KEGG   Homo sapiens (human): 51176Help
Entry
51176             CDS       T01001                                 

Gene name
LEF1, LEF-1, TCF10, TCF1ALPHA, TCF7L3
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing's syndrome
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    51176 (LEF1)
   04390 Hippo signaling pathway
    51176 (LEF1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    51176 (LEF1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    51176 (LEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    51176 (LEF1)
   05210 Colorectal cancer
    51176 (LEF1)
   05225 Hepatocellular carcinoma
    51176 (LEF1)
   05226 Gastric cancer
    51176 (LEF1)
   05216 Thyroid cancer
    51176 (LEF1)
   05221 Acute myeloid leukemia
    51176 (LEF1)
   05217 Basal cell carcinoma
    51176 (LEF1)
   05215 Prostate cancer
    51176 (LEF1)
   05213 Endometrial cancer
    51176 (LEF1)
   05224 Breast cancer
    51176 (LEF1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    51176 (LEF1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    51176 (LEF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    51176 (LEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 51176
NCBI-ProteinID: NP_057353
OMIM: 153245
HGNC: 6551
Ensembl: ENSG00000138795
Vega: OTTHUMG00000131809
Pharos: Q9UJU2(Tchem)
UniProt: Q9UJU2 A0A024RDI7 Q659G9
Position
4q25
AA seq 399 aa AA seqDB search
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcatcccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggtggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcatatgattcccggtcctcctggtccccacacaactggcatccctcat
ccagctattgtaacacctcaggtcaaacaggaacatccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgttgctgag
tgtactctaaaagaaagtgcagctatcaaccagattcttggcagaaggtggcatgccctc
tcccgtgaagagcaggctaaatattatgaattagcacggaaagaaagacagctacatatg
cagctttatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctgcatcaggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system