KEGG   Homo sapiens (human): 51176Help
Entry
51176             CDS       T01001                                 

Gene name
LEF1, LEF-1, TCF10, TCF1ALPHA, TCF7L3
Definition
lymphoid enhancer-binding factor 1
Orthology
K04492  
lymphoid enhancer-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    51176 (LEF1)
   04390 Hippo signaling pathway
    51176 (LEF1)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    51176 (LEF1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    51176 (LEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    51176 (LEF1)
   05210 Colorectal cancer
    51176 (LEF1)
   05216 Thyroid cancer
    51176 (LEF1)
   05221 Acute myeloid leukemia
    51176 (LEF1)
   05217 Basal cell carcinoma
    51176 (LEF1)
   05215 Prostate cancer
    51176 (LEF1)
   05213 Endometrial cancer
    51176 (LEF1)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    51176 (LEF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    51176 (LEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q23-q25
AA seq 371 aa AA seqDB search
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQV
KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESAS
GTGPRMTAAYI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcatcccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggttttcccatcatatgattccc
ggtcctcctggtccccacacaactggcatccctcatccagctattgtaacacctcaggtc
aaacaggaacatccccacactgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaagaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgttgctgagtgtactctaaaagaaagtgcagct
atcaaccagattcttggcagaaggtggcatgccctctcccgtgaagagcaggctaaatat
tatgaattagcacggaaagaaagacagctacatatgcagctttatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaaactacaggaatctgcatca
ggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system