KEGG   Homo sapiens (human): 51179Help
Entry
51179             CDS       T01001                                 

Gene name
HAO2, GIG16, HAOX2
Definition
(RefSeq) hydroxyacid oxidase 2
  KO
K11517  
(S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    51179 (HAO2)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    51179 (HAO2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    51179 (HAO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     51179 (HAO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NYQ3(Tchem)
UniProt: 
Position
1p12
AA seq 351 aa AA seqDB search
MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDT
RTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAA
PEGLRWFQLYVHPDLQLNKQLIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLT
DLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG
IIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGVRTGNDVLKALALGAKCIFLG
RPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSRL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggtgtgtttgacagactttcaggcccatgcgcgagagcagctgtctaagtca
actcgggattttattgaaggtggagcagatgacagcatcacgcgggatgacaacattgca
gcatttaaaagaattcgcctccgtccgcggtacctgagagatgtgtctgaggtggacacc
agaaccacaatccaaggggaggagatcagtgcccctatttgtatcgcacccacagggttc
cactgccttgtctggcctgatggggaaatgagcacagcaagagctgcccaagcggctggt
atctgctacatcaccagcacatttgccagctgtagccttgaagacattgtcattgcagct
cccgaaggcctccgatggttccaactctatgtgcatccagacctgcagctgaacaaacag
ttgatccagagggtagaatccctaggtttcaaagctttggtaataactttggatacacct
gtatgtggcaacaggcgacatgacattcgaaaccagttgaggaggaacttaacactaaca
gatcttcaatcacctaaaaagggaaatgcaataccttatttccagatgactcctatcagc
acttctctctgctggaatgatctctcctggtttcagagcataactcgattgcccatcatc
ctgaaagggattttgacaaaagaggatgcagagttagctgtgaagcacaatgtccagggt
atcattgtttccaaccatggtgggaggcagcttgatgaggttcttgcttcaattgatgct
ttgacagaagtggtggctgctgtaaaggggaaaattgaagtctacctggatggcggggtc
cgaactggcaatgatgtgctgaaggctctggcccttggagctaagtgcatttttcttggg
agaccaatcctatggggccttgcctgcaagggtgaacatggtgttaaggaagttttgaac
attttaacaaatgagttccacacttccatggcccttacaggctgccggtcggtcgctgag
atcaatcgaaacttggtccagttttccaggctgtaa

DBGET integrated database retrieval system