KEGG   Homo sapiens (human): 51181Help
Entry
51181             CDS       T01001                                 

Gene name
DCXR, DCR, HCR2, HCRII, KIDCR, P34H, PNTSU, SDR20C1, XR
Definition
dicarbonyl/L-xylulose reductase (EC:1.1.1.10)
Orthology
K03331  
L-xylulose reductase [EC:1.1.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Disease
H01065  
Pentosuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    51181 (DCXR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     51181 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 242 aa AA seqDB search
MELFLAGRRVLVTGAGKGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLG
DWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGL
IARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVV
MTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFW
AC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttcctcgcgggccgccgggtgctggtcaccggggcaggcaaagggcgcggc
acggtccaggcgctgcacgcgacgggcgcgcgggtggtggctgtgagccggactcaggcg
gatcttgacagccttgtccgcgagtgcccggggatagaacccgtgtgcgtggacctgggt
gactgggaggccaccgagcgggcgctgggcagcgtgggccccgtggacctgctggtgaac
aacgccgctgtcgccctgctgcagcccttcctggaggtcaccaaggaggcctttgacaga
tcctttgaggtgaacctgcgtgcggtcatccaggtgtcgcagattgtggccaggggctta
atagcccggggagtcccaggggccatcgtgaatgtctccagccagtgctcccagcgggca
gtaactaaccatagcgtctactgctccaccaagggtgccctggacatgctgaccaaggtg
atggccctagagctcgggccccacaagatccgagtgaatgcagtaaaccccacagtggtg
atgacgtccatgggccaggccacctggagtgacccccacaaggccaagactatgctgaac
cgaatcccacttggcaagtttgctgaggtagagcacgtggtgaacgccatcctctttctg
ctgagtgaccgaagtggcatgaccacgggttccactttgccggtggaagggggcttctgg
gcctgctga

DBGET integrated database retrieval system