KEGG   Homo sapiens (human): 51206Help
Entry
51206             CDS       T01001                                 

Gene name
GP6, BDPLT11, GPIV, GPVI
Definition
glycoprotein VI (platelet)
Orthology
K06264  
platelet glycoprotein VI
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Platelet activation
Disease
H01235  
Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    51206 (GP6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    51206 (GP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.4
AA seq 620 aa AA seqDB search
MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP
GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC
YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT
TETSRSITASPKESDSPAGESCPPVLHQGQPGPDMPRGCDPNNPGGVSGRGLAQPEEAPA
AQGQGCAEAASAPPAPPADPEIKRGSGWRPTGCSQPRVMFMTAEPQARSYPREGSWHGRR
LKDWRVWSVEAGGQRLQLWKRGHAASSWCSIREPFGQCLSVCLPLCLRAPSIWDGRNLWR
PHPPPCTLWMTWYPGWTTYWPLSSTSLIWAPDGSLRFPALRVDSVPSSVQNPPVLPFGPL
CSCLVFPRNSHPHSISHCGLTNLLSSLRTGLAGSLGMSFIFLSVKLARCPLPFTLENKIS
LCNMVKPHLYQQNKKTQKLARCGGASLYSQQLRGLRWENGLSLGGRGCSELRSHHCTLAR
VTKPDFVSKNTGMNMSITLI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatccccgaccgccctcttctgtcttgggctgtgtctggggcgtgtgccagcg
cagagtggaccgctccccaagccctccctccaggctctgcccagctccctggtgcccctg
gagaagccagtgaccctccggtgccagggacctccgggcgtggacctgtaccgcctggag
aagctgagttccagcaggtaccaggatcaggcagtcctcttcatcccggccatgaagaga
agtctggctggacgctaccgctgctcctaccagaacggaagcctctggtccctgcccagc
gaccagctggagctcgttgccacgggagtttttgccaaaccctcgctctcagcccagccc
ggcccggcggtgtcgtcaggaggggacgtaaccctacagtgtcagactcggtatggcttt
gaccaatttgctctgtacaaggaaggggaccctgcgccctacaagaatcccgagagatgg
tacagggctagttttcccatcatcacggtgaccgccgcccacagcggaacctaccgatgc
tacagcttctccagcagggacccatacctgtggtcagcccccagcgaccccctggagctt
gtggtcacaggaacctctgtgacccccagccggttaccaacagaaccaccttccccggta
gcagaattctcagaagccaccgctgaactgaccgtctcattcacaaacgaagtcttcaca
actgagacttctaggagtatcaccgccagtccaaaggagtcagactctccagctggtgag
tcctgcccgccagtactacaccaagggcaacctggtccggatatgcctcggggctgtgat
cctaataatcctggcggggtttctggcagaggactggcacagccggaggaagcgcctgcg
gcacaggggcagggctgtgcagaggccgcttccgcccctcccgcccctcccgctgacccg
gaaatcaaacgggggtcaggatggaggccgacaggatgttcacagccgcgggttatgttc
atgaccgctgaaccccaggcacggtcgtatccaagggagggatcatggcatgggaggcga
ctcaaagactggcgtgtgtggagcgtggaagcaggagggcagaggctacagctgtggaaa
cgaggccatgctgcctcctcctggtgttccatcagggagccgttcggccagtgtctgtct
gtctgtctgcctctctgtctgagggcaccctccatttgggatggaaggaatctgtggaga
ccccatcctcctccctgcacactgtggatgacatggtaccctggctggaccacatactgg
cctctttcttcaacctctctaatatgggctccagacggatctctaaggttcccagctctc
agggttgactctgttccatcctctgtgcaaaatcctcccgtgcttccctttggccctctg
tgctcttgtctggttttccccagaaactctcaccctcactccatctcccactgcggtcta
acaaatctcctttcgtctctcagaacgggtcttgcaggcagtttgggtatgtcattcatt
ttccttagtgtaaaactagcacgttgcccgcttcccttcacattagaaaacaagatcagc
ctgtgcaacatggtgaaacctcatctctaccaacaaaacaaaaaaacacaaaaattagcc
aggtgtggtggtgcatccctatactcccagcaactcagggggctgaggtgggagaatggc
ttgagcctgggaggcagaggttgcagtgagctgagatcacaccactgcactctagctcgg
gtgacgaagcctgactttgtctcaaaaaatacagggatgaatatgtcaattaccctgatt
tga

DBGET integrated database retrieval system