KEGG   Homo sapiens (human): 51208Help
Entry
51208             CDS       T01001                                 

Gene name
CLDN18, SFTA5, SFTPJ
Definition
(RefSeq) claudin 18
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    51208 (CLDN18)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    51208 (CLDN18)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    51208 (CLDN18)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    51208 (CLDN18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   51208 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   51208 (CLDN18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 51208
NCBI-ProteinID: NP_001002026
OMIM: 609210
HGNC: 2039
Ensembl: ENSG00000066405
Vega: OTTHUMG00000159762
Pharos: P56856(Tbio)
UniProt: P56856
Position
3q22.3
AA seq 261 aa AA seqDB search
MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGF
TECRGYFTLLGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
YDGGARTEDEVQSYPSKHDYV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgactgcctgtcagggcttggggttcgtggtttcactgattgggattgcgggc
atcattgctgccacctgcatggaccagtggagcacccaagacttgtacaacaaccccgta
acagctgttttcaactaccaggggctgtggcgctcctgtgtccgagagagctctggcttc
accgagtgccggggctacttcaccctgctggggctgccagccatgctgcaggcagtgcga
gccctgatgatcgtaggcatcgtcctgggtgccattggcctcctggtatccatctttgcc
ctgaaatgcatccgcattggcagcatggaggactctgccaaagccaacatgacactgacc
tccgggatcatgttcattgtctcaggtctttgtgcaattgctggagtgtctgtgtttgcc
aacatgctggtgactaacttctggatgtccacagctaacatgtacaccggcatgggtggg
atggtgcagactgttcagaccaggtacacatttggtgcggctctgttcgtgggctgggtc
gctggaggcctcacactaattgggggtgtgatgatgtgcatcgcctgccggggcctggca
ccagaagaaaccaactacaaagccgtttcttatcatgcctcaggccacagtgttgcctac
aagcctggaggcttcaaggccagcactggctttgggtccaacaccaaaaacaagaagata
tacgatggaggtgcccgcacagaggacgaggtacaatcttatccttccaagcacgactat
gtgtaa

DBGET integrated database retrieval system