KEGG   Homo sapiens (human): 51208Help
Entry
51208             CDS       T01001                                 

Gene name
CLDN18, SFTA5, SFTPJ
Definition
claudin 18
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    51208 (CLDN18)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    51208 (CLDN18)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    51208 (CLDN18)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    51208 (CLDN18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   51208 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   51208 (CLDN18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22.3
AA seq 261 aa AA seqDB search
MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGF
TECRGYFTLLGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
YDGGARTEDEVQSYPSKHDYV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgactgcctgtcagggcttggggttcgtggtttcactgattgggattgcgggc
atcattgctgccacctgcatggaccagtggagcacccaagacttgtacaacaaccccgta
acagctgttttcaactaccaggggctgtggcgctcctgtgtccgagagagctctggcttc
accgagtgccggggctacttcaccctgctggggctgccagccatgctgcaggcagtgcga
gccctgatgatcgtaggcatcgtcctgggtgccattggcctcctggtatccatctttgcc
ctgaaatgcatccgcattggcagcatggaggactctgccaaagccaacatgacactgacc
tccgggatcatgttcattgtctcaggtctttgtgcaattgctggagtgtctgtgtttgcc
aacatgctggtgactaacttctggatgtccacagctaacatgtacaccggcatgggtggg
atggtgcagactgttcagaccaggtacacatttggtgcggctctgttcgtgggctgggtc
gctggaggcctcacactaattgggggtgtgatgatgtgcatcgcctgccggggcctggca
ccagaagaaaccaactacaaagccgtttcttatcatgcctcaggccacagtgttgcctac
aagcctggaggcttcaaggccagcactggctttgggtccaacaccaaaaacaagaagata
tacgatggaggtgcccgcacagaggacgaggtacaatcttatccttccaagcacgactat
gtgtaa

DBGET integrated database retrieval system