KEGG   Homo sapiens (human): 51209Help
Entry
51209             CDS       T01001                                 

Gene name
RAB9B, RAB9L, Rab-9L
Definition
RAB9B, member RAS oncogene family
Orthology
K07900  
Ras-related protein Rab-9B
Organism
hsa  Homo sapiens (human)
Pathway
Measles
Class
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22.1-q22.3
AA seq 201 aa AA seqDB search
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFV
VLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE
HCMLGHTIDLNSGSKAGSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaaatccctgctcttaaaggtcattctcttgggtgatggtggagttgggaaa
agttcgcttatgaaccgttacgtaaccaacaaatttgactcccaggcttttcacaccata
ggggtagagttcttaaatcgagatctggaggtagatggacgctttgtaaccctccagatc
tgggacactgcagggcaggaacgtttcaagagccttaggacacccttctacaggggagca
gactgctgcctcttgaccttcagcgtggatgatcggcagagcttcgagaatcttggtaac
tggcagaaagaatttatttactatgcggatgtgaaggaccctgagcatttcccctttgta
gttctgggtaacaaggtagacaaagaggataggcaagtgactactgaggaggcacaaacc
tggtgcatggagaatggggattacccttatttagaaactagtgccaaagatgatactaat
gtgacagtggcctttgaagaagctgtcaggcaggtgctggctgtagaggaacagctggag
cattgcatgttgggtcacaccattgacttgaacagtggctccaaagcagggtcttcgtgc
tgttaa

DBGET integrated database retrieval system