KEGG   Homo sapiens (human): 51218Help
Entry
51218             CDS       T01001                                 

Gene name
GLRX5, C14orf87, FLB4739, GRX5, PR01238, PRO1238
Definition
glutaredoxin 5
Orthology
K07390  
monothiol glutaredoxin
Organism
hsa  Homo sapiens (human)
Disease
H00201  
Erythropoietic porphyria (EP)
H00982  
Sideroblastic anemia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.13
AA seq 157 aa AA seqDB search
MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKG
TPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
GCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggtccctcggccgagctgcggcggctctgctccgctgggggcgcggcgcgggc
ggcggtggcctttggggtccgggcgtgcgggcggcgggctcgggcgcgggcggcggcggc
tcggcggagcagttggacgcgctggtgaagaaggacaaggtggtggtcttcctcaagggg
acgccggagcagccccagtgcggcttcagcaacgccgtggtgcagatcctgcggctgcac
ggcgtccgcgattacgcggcctacaacgtgctggacgacccggagctccgacaaggcatt
aaagactattccaactggcccaccatcccgcaagtgtacctcaatggcgagtttgtaggg
ggctgtgacattcttctgcagatgcaccagaatggggacttggtggaagaactgaaaaag
ctggggatccactccgcccttttagatgaaaagaaagaccaagactccaagtga

DBGET integrated database retrieval system