KEGG   Homo sapiens (human): 51246Help
Entry
51246             CDS       T01001                                 

Gene name
SHISA5, SCOTIN
Definition
shisa family member 5
Orthology
K10135  
scotin
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Class
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 233 aa AA seqDB search
MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSD
VLKKFVWSEESVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIIC
FTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMP
AAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgccggtccccgcgccgcggatcctgttgccgttgctgttgctgctgctgcta
acgccgcctccgggtgcacgtggtgaggtgtgtatggcttcccgtggactcagcctcttc
cccgagtcctgtccagatttctgctgtggtacctgtgatgaccaatactgctgctctgac
gtgctgaagaaatttgtgtggagcgaggaaagcgtgcctgccagtgtagagccggtggag
cagctgggctcggcgctgaggtttcgccctggctacaacgaccccatgtcagggttcgga
gcgaccttggccgttggcctgaccatctttgtgctgtctgtcgtcactatcatcatctgc
ttcacctgctcctgctgctgcctttacaagacgtgccgccgaccacgtccggttgtcacc
accaccacatccaccactgtggtgcatgccccttatcctcagcctccaagtgtgccgccc
agctaccctggaccaagctaccagggctaccacaccatgccgcctcagccagggatgcca
gcagcaccctacccaatgcagtacccaccaccttacccagcccagcccatgggcccaccg
gcctaccacgagaccctggctggaggagcagccgcgccctaccccgccagccagcctcct
tacaacccggcctacatggatgccccgaaggcggccctctga

DBGET integrated database retrieval system