KEGG   Homo sapiens (human): 51246Help
Entry
51246             CDS       T01001                                 

Gene name
SHISA5, SCOTIN
Definition
(RefSeq) shisa family member 5
  KO
K10135  scotin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    51246 (SHISA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Shisa
Motif
Other DBs
NCBI-GeneID: 51246
NCBI-ProteinID: NP_057563
OMIM: 607290
HGNC: 30376
Ensembl: ENSG00000164054
Vega: OTTHUMG00000133529
Pharos: Q8N114(Tbio)
UniProt: Q8N114
Position
3p21.31
AA seq 240 aa AA seqDB search
MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSD
VLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLS
VVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTM
PPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgccggtccccgcgccgcggatcctgttgccgttgctgttgctgctgctgcta
acgccgcctccgggtgcacgtggtgaggtgtgtatggcttcccgtggactcagcctcttc
cccgagtcctgtccagatttctgctgtggtacctgtgatgaccaatactgctgctctgac
gtgctgaagaaatttgtgtggagcgaggaaaggtgtgctgtgcctgaggccagcgtgcct
gccagtgtagagccggtggagcagctgggctcggcgctgaggtttcgccctggctacaac
gaccccatgtcagggttcggagcgaccttggccgttggcctgaccatctttgtgctgtct
gtcgtcactatcatcatctgcttcacctgctcctgctgctgcctttacaagacgtgccgc
cgaccacgtccggttgtcaccaccaccacatccaccactgtggtgcatgccccttatcct
cagcctccaagtgtgccgcccagctaccctggaccaagctaccagggctaccacaccatg
ccgcctcagccagggatgccagcagcaccctacccaatgcagtacccaccaccttaccca
gcccagcccatgggcccaccggcctaccacgagaccctggctggaggagcagccgcgccc
taccccgccagccagcctccttacaacccggcctacatggatgccccgaaggcggccctc
tga

DBGET integrated database retrieval system