KEGG   Homo sapiens (human): 51251Help
Entry
51251             CDS       T01001                                 

Gene name
NT5C3A, NT5C3, P5'N-1, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1, cN-III, hUMP1, p36
Definition
(RefSeq) 5'-nucleotidase, cytosolic IIIA (EC:3.1.3.5 3.1.3.91)
  KO
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Disease
H00674  
Anemia due to disorders of nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    51251 (NT5C3A)
   00240 Pyrimidine metabolism
    51251 (NT5C3A)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    51251 (NT5C3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     51251 (NT5C3A)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   51251 (NT5C3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 336 aa AA seqDB search
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagggccccgtccatggaccgcgcggccgtggcgagggtgggcgcggtagcgagcgcc
agcgtgtgcgccctggtggcgggggtggtgctggctcagtacatattcaccttgaagagg
aagacggggcggaagaccaagatcatcgagatgatgccagaattccagaaaagttcagtt
cgaatcaagaaccctacaagagtagaagaaattatctgtggtcttatcaaaggaggagct
gccaaacttcagataataacggactttgatatgacactcagtagattttcatataaaggg
aaaagatgcccaacatgtcataatatcattgacaactgtaagctggttacagatgaatgt
agaaaaaagttattgcaactaaaggaaaaatattacgctattgaagttgatcctgttctt
actgtagaagagaagtacccttatatggtggaatggtatactaaatcacatggtttgctt
gttcagcaagctttaccaaaagctaaacttaaagaaattgtggcagaatctgacgttatg
ctcaaagaaggatatgagaatttctttgataagctccaacaacatagcatccccgtgttc
atattttcggctggaatcggcgatgtactagaggaagttattcgtcaagctggtgtttat
catcccaatgtcaaagttgtgtccaattttatggattttgatgaaactggggtgctcaaa
ggatttaaaggagaactaattcatgtatttaacaaacatgatggtgccttgaggaataca
gaatatttcaatcaactaaaagacaatagtaacataattcttctgggagactcccaagga
gacttaagaatggcagatggagtggccaatgttgagcacattctgaaaattggatatcta
aatgatagagtggatgagcttttagaaaagtacatggactcttatgatattgttttagta
caagatgaatcattagaagtagccaactctattttacagaagattctataa

DBGET integrated database retrieval system