KEGG   Homo sapiens (human): 5128Help
Entry
5128              CDS       T01001                                 

Gene name
CDK17, PCTAIRE2, PCTK2
Definition
(RefSeq) cyclin-dependent kinase 17 (EC:2.7.11.22)
  KO
K15595  
cyclin-dependent kinase 17 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5128 (CDK17)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   5128 (CDK17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.1
AA seq 523 aa AA seqDB search
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQ
YTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEV
QSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRAS
LSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVS
LLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRG
LAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVL
LGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE
EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRI
HALPESVSIFSLKEIQLQKDPGFRNSSYPETGVFVINHFTCRS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaagagaaggctatccctcacactccgaggaagtcagactattgatgaa
tcattgtctgaattggctgaacaaatgactattgaagaaaacagcagcaaggataatgag
cctattgtgaagaatggcaggcctccaacgtctcacagtatgcattccttcctccaccag
tacacaggatctttcaagaagcccccattgcggagaccacacagtgttattggagggagc
cttggctccttcatggcaatgcccagaaatggaagcagattagatattgttcatgaaaat
ctaaaaatgggatcagatggtgagagtgaccaagcttctgggacatcatctgatgaagtc
cagtcacctacaggtgtttgtctcagaaatcgtatacatagacggatctcaatggaggat
ttaaataagcggttatcactgcctgcagacatcagaatacctgatggatatcttgaaaag
ttgcagataaacagtccaccatttgaccaaccaatgagtcgaaggtctcgtagagcttcc
ttatcagaaattggctttggaaaaatggaaacctacatcaaattggaaaagcttggagag
ggtacatatgcaacagtatataaaggaagaagtaaattgacagagaatttggtggcatta
aaagagatccgattggaacatgaagaaggtgcaccctgcacagctataagagaagtttca
ctattaaaggatttaaaacatgcaaatatagtaaccttacatgacattgttcacacagat
aaatccttgactttggtgtttgagtatctggataaagacctgaaacagtacatggatgac
tgtggaaacatcatgagtatgcacaacgtaaagctgtttctgtaccaaattctacgtggt
ttggcatattgccatagaagaaaggtattgcatcgagacttgaaaccacagaacctcctc
attaatgagaaaggagaattaaagctagcagattttggactagcccgagccaagtcagtt
cccacaaagacctactcaaatgaagttgtcacactatggtaccggccacctgatgtgctt
cttggttcctcggagtactcaacacagattgacatgtggggtgttggttgcattttcttt
gaaatggcttctggaagacctttatttccaggatcaaccgtggaagatgaactgcactta
attttccgactgctaggaactccatctcaggaaacttggccaggtatttcttcaaatgag
gagttcaagaactacaactttccaaaatataaaccacagcctctaattaaccacgcaccc
aggttagactctgaaggaattgagttgataacaaaatttcttcagtatgaatctaagaaa
agggtttcagctgaagaggccatgaaacatgtgtactttcgaagtctgggaccaagaata
catgctttaccagaaagtgtatcaatattcagtttgaaagagattcagttgcaaaaggac
ccgggttttcgaaattcttcttatccagagacaggtgtgtttgtcataaaccatttcacg
tgtcgatcatga

DBGET integrated database retrieval system