KEGG   Homo sapiens (human): 51280Help
Entry
51280             CDS       T01001                                 

Gene name
GOLM1, C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3
Definition
(RefSeq) golgi membrane protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21.33
AA seq 401 aa AA seqDB search
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAER
GAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVL
QDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKK
GNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSS
EVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP
QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES
ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcttgggaaacgggcgtcgcagcatgaagtcgccgcccctcgtgctggccgcc
ctggtggcctgcatcatcgtcttgggcttcaactactggattgcgagctcccggagcgtg
gacctccagacacggatcatggagctggaaggcagggtccgcagggcggctgcagagaga
ggcgccgtggagctgaagaagaacgagttccagggagagctggagaagcagcgggagcag
cttgacaaaatccagtccagccacaacttccagctggagagcgtcaacaagctgtaccag
gacgaaaaggcggttttggtgaataacatcaccacaggtgagaggctcatccgagtgctg
caagaccagttaaagaccctgcagaggaattacggcaggctgcagcaggatgtcctccag
tttcagaagaaccagaccaacctggagaggaagttctcctacgacctgagccagtgcatc
aatcagatgaaggaggtgaaggaacagtgtgaggagcgaatagaagaggtcaccaaaaag
gggaatgaagctgtagcttccagagacctgagtgaaaacaacgaccagagacagcagctc
caagccctcagtgagcctcagcccaggctgcaggcagcaggcctgccacacacagaggtg
ccacaagggaagggaaacgtgcttggtaacagcaagtcccagacaccagcccccagttcc
gaagtggttttggattcaaagagacaagttgagaaagaggaaaccaatgagatccaggtg
gtgaatgaggagcctcagagggacaggctgccgcaggagccaggccgggagcaggtggtg
gaagacagacctgtaggtggaagaggcttcgggggagccggagaactgggccagacccca
caggtgcaggctgccctgtcagtgagccaggaaaatccagagatggagggccctgagcga
gaccagcttgtcatccccgacggacaggaggaggagcaggaagctgccggggaagggaga
aaccagcagaaactgagaggagaagatgactacaacatggatgaaaatgaagcagaatct
gagacagacaagcaagcagccctggcagggaatgacagaaacatagatgtttttaatgtt
gaagatcagaaaagagacaccataaatttacttgatcagcgtgaaaagcggaatcataca
ctctga

DBGET integrated database retrieval system