KEGG   Homo sapiens (human): 51284Help
Entry
51284             CDS       T01001                                 

Gene name
TLR7, TLR7-like
Definition
toll-like receptor 7
Orthology
K05404  
toll-like receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Measles
Influenza A
Drug target
Imiquimod: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    51284 (TLR7)
 Human Diseases
  Infectious diseases
   05162 Measles
    51284 (TLR7)
   05164 Influenza A
    51284 (TLR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3
AA seq 1049 aa AA seqDB search
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttccaatgtggacactgaagagacaaattcttatcctttttaacataatccta
atttccaaactccttggggctagatggtttcctaaaactctgccctgtgatgtcactctg
gatgttccaaagaaccatgtgatcgtggactgcacagacaagcatttgacagaaattcct
ggaggtattcccacgaacaccacgaacctcaccctcaccattaaccacataccagacatc
tccccagcgtcctttcacagactggaccatctggtagagatcgatttcagatgcaactgt
gtacctattccactggggtcaaaaaacaacatgtgcatcaagaggctgcagattaaaccc
agaagctttagtggactcacttatttaaaatccctttacctggatggaaaccagctacta
gagataccgcagggcctcccgcctagcttacagcttctcagccttgaggccaacaacatc
ttttccatcagaaaagagaatctaacagaactggccaacatagaaatactctacctgggc
caaaactgttattatcgaaatccttgttatgtttcatattcaatagagaaagatgccttc
ctaaacttgacaaagttaaaagtgctctccctgaaagataacaatgtcacagccgtccct
actgttttgccatctactttaacagaactatatctctacaacaacatgattgcaaaaatc
caagaagatgattttaataacctcaaccaattacaaattcttgacctaagtggaaattgc
cctcgttgttataatgccccatttccttgtgcgccgtgtaaaaataattctcccctacag
atccctgtaaatgcttttgatgcgctgacagaattaaaagttttacgtctacacagtaac
tctcttcagcatgtgcccccaagatggtttaagaacatcaacaaactccaggaactggat
ctgtcccaaaacttcttggccaaagaaattggggatgctaaatttctgcattttctcccc
agcctcatccaattggatctgtctttcaattttgaacttcaggtctatcgtgcatctatg
aatctatcacaagcattttcttcactgaaaagcctgaaaattctgcggatcagaggatat
gtctttaaagagttgaaaagctttaacctctcgccattacataatcttcaaaatcttgaa
gttcttgatcttggcactaactttataaaaattgctaacctcagcatgtttaaacaattt
aaaagactgaaagtcatagatctttcagtgaataaaatatcaccttcaggagattcaagt
gaagttggcttctgctcaaatgccagaacttctgtagaaagttatgaaccccaggtcctg
gaacaattacattatttcagatatgataagtatgcaaggagttgcagattcaaaaacaaa
gaggcttctttcatgtctgttaatgaaagctgctacaagtatgggcagaccttggatcta
agtaaaaatagtatattttttgtcaagtcctctgattttcagcatctttctttcctcaaa
tgcctgaatctgtcaggaaatctcattagccaaactcttaatggcagtgaattccaacct
ttagcagagctgagatatttggacttctccaacaaccggcttgatttactccattcaaca
gcatttgaagagcttcacaaactggaagttctggatataagcagtaatagccattatttt
caatcagaaggaattactcatatgctaaactttaccaagaacctaaaggttctgcagaaa
ctgatgatgaacgacaatgacatctcttcctccaccagcaggaccatggagagtgagtct
cttagaactctggaattcagaggaaatcacttagatgttttatggagagaaggtgataac
agatacttacaattattcaagaatctgctaaaattagaggaattagacatctctaaaaat
tccctaagtttcttgccttctggagtttttgatggtatgcctccaaatctaaagaatctc
tctttggccaaaaatgggctcaaatctttcagttggaagaaactccagtgtctaaagaac
ctggaaactttggacctcagccacaaccaactgaccactgtccctgagagattatccaac
tgttccagaagcctcaagaatctgattcttaagaataatcaaatcaggagtctgacgaag
tattttctacaagatgccttccagttgcgatatctggatctcagctcaaataaaatccag
atgatccaaaagaccagcttcccagaaaatgtcctcaacaatctgaagatgttgcttttg
catcataatcggtttctgtgcacctgtgatgctgtgtggtttgtctggtgggttaaccat
acggaggtgactattccttacctggccacagatgtgacttgtgtggggccaggagcacac
aagggccaaagtgtgatctccctggatctgtacacctgtgagttagatctgactaacctg
attctgttctcactttccatatctgtatctctctttctcatggtgatgatgacagcaagt
cacctctatttctgggatgtgtggtatatttaccatttctgtaaggccaagataaagggg
tatcagcgtctaatatcaccagactgttgctatgatgcttttattgtgtatgacactaaa
gacccagctgtgaccgagtgggttttggctgagctggtggccaaactggaagacccaaga
gagaaacattttaatttatgtctcgaggaaagggactggttaccagggcagccagttctg
gaaaacctttcccagagcatacagcttagcaaaaagacagtgtttgtgatgacagacaag
tatgcaaagactgaaaattttaagatagcattttacttgtcccatcagaggctcatggat
gaaaaagttgatgtgattatcttgatatttcttgagaagccctttcagaagtccaagttc
ctccagctccggaaaaggctctgtgggagttctgtccttgagtggccaacaaacccgcaa
gctcacccatacttctggcagtgtctaaagaacgccctggccacagacaatcatgtggcc
tatagtcaggtgttcaaggaaacggtctag

DBGET integrated database retrieval system