KEGG   Homo sapiens (human): 51289Help
Entry
51289             CDS       T01001                                 

Gene name
RXFP3, GPCR135, RLN3R1, RXFPR3, SALPR
Definition
(RefSeq) relaxin/insulin like family peptide receptor 3
  KO
K08397  
relaxin family peptide receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51289 (RXFP3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Pancreatic peptide
   Relaxin
    51289 (RXFP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
5p15.1-p14
AA seq 469 aa AA seqDB search
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA
PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF
VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR
YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK
VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA
GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS
QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA
TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcagatggccgatgcagccacgatagccaccatgaataaggcagcaggcggggacaag
ctagcagaactcttcagtctggtcccggaccttctggaggcggccaacacgagtggtaac
gcgtcgctgcagcttccggacttgtggtgggagctggggctggagttgccggacggcgcg
ccgccaggacatcccccgggcagcggcggggcagagagcgcggacacagaggcccgggtg
cggattctcatcagcgtggtgtactgggtggtgtgcgccctggggttggcgggcaacctg
ctggttctctacctgatgaagagcatgcagggctggcgcaagtcctctatcaacctcttc
gtcaccaacctggcgctgacggactttcagtttgtgctcaccctgcccttctgggcggtg
gagaacgctcttgacttcaaatggcccttcggcaaggccatgtgtaagatcgtgtccatg
gtgacgtccatgaacatgtacgccagcgtgttcttcctcactgccatgagtgtgacgcgc
taccattcggtggcctcggctctgaagagccaccggacccgaggacacggccggggcgac
tgctgcggccggagcctgggggacagctgctgcttctcggccaaggcgctgtgtgtgtgg
atctgggctttggccgcgctggcctcgctgcccagtgccattttctccaccacggtcaag
gtgatgggcgaggagctgtgcctggtgcgtttcccggacaagttgctgggccgcgacagg
cagttctggctgggcctctaccactcgcagaaggtgctgctgggcttcgtgctgccgctg
ggcatcattatcttgtgctacctgctgctggtgcgcttcatcgccgaccgccgcgcggcg
gggaccaaaggaggggccgcggtagccggaggacgcccgaccggagccagcgcccggaga
ctgtcgaaggtcaccaaatcagtgaccatcgttgtcctgtccttcttcctgtgttggctg
cccaaccaggcgctcaccacctggagcatcctcatcaagttcaacgcggtgcccttcagc
caggagtatttcctgtgccaggtatacgcgttccctgtgagcgtgtgcctagcgcactcc
aacagctgcctcaaccccgtcctctactgcctcgtgcgccgcgagttccgcaaggcgctc
aagagcctgctgtggcgcatcgcgtctccttcgatcaccagcatgcgccccttcaccgcc
actaccaagccggagcacgaggatcaggggctgcaggccccggcgccgccccacgcggcc
gcggagccggacctgctctactacccacctggcgtcgtggtctacagcggggggcgctac
gacctgctgcccagcagctctgcctactga

DBGET integrated database retrieval system